KEGG   Caenorhabditis elegans (nematode): CELE_ZK370.5Help
Entry
CELE_ZK370.5      CDS       T00019                                 

Gene name
pdhk-2
Definition
Protein PDHK-2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(8737962..8738210,8738492..8738599,8738993..8739091,8739357..8739492,8740333..8740436,8740487..8740673,8740782..8741036,8741264..8741331))
Genome map
AA seq 401 aa AA seqDB search
MRFSRKLLGPFVGSLAKKLDYYSQFQPSSLTIQQYLDFGRIGTSANSYTFLKNELLVRLA
NIMQEFTLLPPKLLQMPSSKMVSNWYAESFEDLLLFEASDSSPEQVARFNDQLTVVLKRH
AHVVETMAEGLIELRESDGVDIASEKGIQYFLDRFYINRISIRMLQNQHLVVFGNVLPES
PRHVGCIDPACDVESVVYDAFENARFLCDRYYLTSPSMKLEMHNAVEKGKPISIVAVPSH
LYHMMFELFKNAMRATVEYHGVDDDLPDIKVYVVKGQEDLSIKICDRGGGVSRTILERLY
NYMYSTAPPPPRDGTQAPLAGYGYGLPLSRLYARYFLGDLFLVSMEGHGTDACIYLKAVP
VEASEVLPIYSTSSRRNLTMGPQVADWSHHVPGQGNRPAQS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttttcgcggaagttactaggccctttcgtgggttcattggccaagaaactcgat
tattatagtcaatttcaaccttcatcacttacaattcaacaatatttggatttcggtcga
ataggaacatcagcaaattcatacacatttttgaaaaatgagcttctcgttcgtttggcg
aatattatgcaggaattcacacttcttccaccaaagcttcttcaaatgccaagttcaaaa
atggtatcaaattggtatgctgagagtttcgaggatcttcttttgttcgaggcatctgat
tcatctccagagcaagttgcaagattcaatgatcagttaacagtcgtactgaaaagacac
gcacatgtcgtcgaaacaatggctgaaggattgattgaacttcgagaatcggatggagta
gatattgcaagtgaaaaaggaattcaatatttcttggatcgattttacatcaacagaatt
tccattcgtatgcttcaaaatcaacatctggttgtattcggaaatgttctcccagaaagt
cctcgtcatgttggatgtattgatcctgcctgtgatgtggaaagtgtagtgtacgatgct
tttgaaaatgctcgatttctatgtgatcgatactacttgacaagtccatcaatgaagctt
gaaatgcacaatgccgttgaaaaaggaaaaccaatatcgattgtcgccgtaccaagtcat
ctctatcacatgatgttcgaactgtttaagaatgcaatgagagcgacagttgaatatcat
ggagttgatgatgatcttccagatattaaagtttatgtagtcaaaggacaagaggattta
tctattaagatttgtgatcgtggaggaggtgtatccagaactattctcgaacgtctctac
aactacatgtactcaacagctccaccaccgccacgtgatggaacacaagctcctttggct
ggttacggatacggactgccactatctcgactatacgctcggtatttccttggtgacctc
tttttggtttccatggaaggacatggaacggatgcatgtatctacttgaaagctgtacca
gttgaggctagtgaagtactcccaatttatagtacttcttcgcgtcgaaatttgacaatg
ggaccacaagtagctgattggtcgcatcatgttcctggtcaaggaaatcgtccagctcaa
tcatga

DBGET integrated database retrieval system