KEGG   Caenorhabditis elegans (nematode): CELE_ZK370.5Help
Entry
CELE_ZK370.5      CDS       T00019                                 

Gene name
pdhk-2
Definition
Protein PDHK-2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CELE_ZK370.5 (pdhk-2)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CELE_ZK370.5 (pdhk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(8738043..8738291,8738573..8738680,8739074..8739172,8739438..8739573,8740414..8740517,8740568..8740754,8740863..8741117,8741345..8741412))
Genome map
AA seq 401 aa AA seqDB search
MRFSRKLLGPFVGSLAKKLDYYSQFQPSSLTIQQYLDFGRIGTSANSYTFLKNELLVRLA
NIMQEFTLLPPKLLQMPSSKMVSNWYAESFEDLLLFEASDSSPEQVARFNDQLTVVLKRH
AHVVETMAEGLIELRESDGVDIASEKGIQYFLDRFYINRISIRMLQNQHLVVFGNVLPES
PRHVGCIDPACDVESVVYDAFENARFLCDRYYLTSPSMKLEMHNAVEKGKPISIVAVPSH
LYHMMFELFKNAMRATVEYHGVDDDLPDIKVYVVKGQEDLSIKICDRGGGVSRTILERLY
NYMYSTAPPPPRDGTQAPLAGYGYGLPLSRLYARYFLGDLFLVSMEGHGTDACIYLKAVP
VEASEVLPIYSTSSRRNLTMGPQVADWSHHVPGQGNRPAQS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttttcgcggaagttactaggccctttcgtgggttcattggccaagaaactcgat
tattatagtcaatttcaaccttcatcacttacaattcaacaatatttggatttcggtcga
ataggaacatcagcaaattcatacacatttttgaaaaatgagcttctcgttcgtttggcg
aatattatgcaggaattcacacttcttccaccaaagcttcttcaaatgccaagttcaaaa
atggtatcaaattggtatgctgagagtttcgaggatcttcttttgttcgaggcatctgat
tcatctccagagcaagttgcaagattcaatgatcagttaacagtcgtactgaaaagacac
gcacatgtcgtcgaaacaatggctgaaggattgattgaacttcgagaatcggatggagta
gatattgcaagtgaaaaaggaattcaatatttcttggatcgattttacatcaacagaatt
tccattcgtatgcttcaaaatcaacatctggttgtattcggaaatgttctcccagaaagt
cctcgtcatgttggatgtattgatcctgcctgtgatgtggaaagtgtagtgtacgatgct
tttgaaaatgctcgatttctatgtgatcgatactacttgacaagtccatcaatgaagctt
gaaatgcacaatgccgttgaaaaaggaaaaccaatatcgattgtcgccgtaccaagtcat
ctctatcacatgatgttcgaactgtttaagaatgcaatgagagcgacagttgaatatcat
ggagttgatgatgatcttccagatattaaagtttatgtagtcaaaggacaagaggattta
tctattaagatttgtgatcgtggaggaggtgtatccagaactattctcgaacgtctctac
aactacatgtactcaacagctccaccaccgccacgtgatggaacacaagctcctttggct
ggttacggatacggactgccactatctcgactatacgctcggtatttccttggtgacctc
tttttggtttccatggaaggacatggaacggatgcatgtatctacttgaaagctgtacca
gttgaggctagtgaagtactcccaatttatagtacttcttcgcgtcgaaatttgacaatg
ggaccacaagtagctgattggtcgcatcatgttcctggtcaaggaaatcgtccagctcaa
tcatga

DBGET integrated database retrieval system