KEGG   Caenorhabditis elegans (nematode): CELE_ZK430.2Help
Entry
CELE_ZK430.2      CDS       T00019                                 

Gene name
tag-231
Definition
Protein TAG-231
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cel00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(4420308..4420388,4420523..4420675,4420738..4421062,4421812..4422212)
Genome map
AA seq 319 aa AA seqDB search
MFNKASFLTRLVASSVRVSEAAGGLIKNVMAGGDLKIIDKSEHGSGYDPQTEADRRAQYC
IVQSLQKHFKNINIIGEEEDTTACPEIEMGFSADVLQMERLMSTELKNIQENDVVVWVDP
LDGTSEVALAVKNKNMALLEQVTVLIGIAYKGRPVAGIIHQPYHEKLGRTVWAIQGCGVH
GVVPATGNAQKIVVTTRSHLSESVSNALEALKTRNLADSVEKVGGAGFKVLKVLEGCAAY
VFASAGCKKWDTCAVEAVLTAAGGTLTDISGRDIRYEPGVQLNNTGGVLATASWVKHKDY
IDTIPQEIKNMLPEISSKK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaaagcgagttttctcacgagactcgtcgcctcgtctgtccgagtttcagag
gctgccgggggtcttattaaaaatgtcatggccggcggagatctcaaaatcatcgataaa
tcggagcacggatccggctacgatccacaaacggaagcagatcgtcgggctcaatactgc
atagttcagtctctgcagaagcatttcaagaatattaatattatcggcgaagaggaagac
acaactgcttgcccggaaatcgaaatgggattcagtgcggacgtgctccaaatggaacgc
ctgatgagcacggagctcaagaatatccaggaaaatgatgttgtagtctgggtggatccg
ttggatggaacatcagaagtcgcgttggcagttaagaataagaatatggcattgttggag
caggtcactgtgttgattggaatcgcgtataagggacgaccggtggctggaattattcat
caaccatatcatgagaagcttggaaggacggtttgggcgattcaaggttgtggagttcat
ggagttgttccggctactggaaatgctcaaaaaatcgtggtgacaactcgaagccatctc
agcgaatctgtctccaacgccctcgaagctctgaaaactcgaaatttggcggatagcgtt
gaaaaagtcggtggagccggattcaaggtgctcaaagttctggaagggtgtgcagcgtat
gtctttgcaagtgctggttgtaagaaatgggacacgtgtgcagttgaagccgtgttgact
gctgctggaggaactcttacggacatttcgggccgtgatattcgatatgagcccggtgtg
cagcttaataatacgggaggagtactggcgacggcttcatgggtcaagcataaggattat
atcgatacgattccacaagaaatcaagaatatgttgccggagatttcatcgaaaaagtga

DBGET integrated database retrieval system