KEGG   Caenorhabditis elegans (nematode): CELE_ZK856.8Help
Entry
CELE_ZK856.8      CDS       T00019                                 

Gene name
ZK856.8
Definition
Protein ZK856.8
Orthology
K17610  
calcineurin B homologous protein 1
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CELE_ZK856.8 (ZK856.8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(10202717..10202955,10203001..10203225,10203276..10203332,10203410..10203476))
Genome map
AA seq 195 aa AA seqDB search
MGNSSSLMLRDEEIEEIMSETEFNRNQIVRLYSRFLSLDKKGQGFLSRDDFLNVPELAVN
PLGDRIVDAFFTLASSNGDNEEQQLNFRQFVRILAHFQPISRVKKNALNSRKDKLLFAFK
MYDLNKNDYITREEFKVILNSMVGANITSDQLDKIADRTIEEADADRDGKISFDEFCRAM
EKTDIEEKMSIRFLN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacagcagttctttaatgttacgagatgaggagattgaggaaataatgagtgaa
acagaatttaacagaaatcaaattgtccgactctacagccgatttttatcacttgataaa
aaaggacagggatttctttcacgagacgattttttgaatgttcccgagttggctgtgaat
cctcttggtgatcgaatcgtagatgcctttttcacattagcttcttcaaacggtgacaac
gaagagcaacagttgaactttcgtcaatttgttcgaattcttgcacactttcaaccgatt
tcaagagtaaagaaaaatgctctcaactcgagaaaagacaaattgctttttgcgttcaaa
atgtacgatttaaataaaaacgactacatcacacgtgaagaattcaaagtcattctgaac
agtatggttggtgccaatataacttctgatcaactcgacaagattgctgatcgaacgatt
gaggaagctgatgcagatcgtgatggaaaaatttcttttgatgagttttgtcgagcaatg
gaaaaaactgatattgaggagaagatgtcgattcgattcctaaactaa

DBGET integrated database retrieval system