KEGG   Caenorhabditis elegans (nematode): CELE_ZK863.3Help
Entry
CELE_ZK863.3      CDS       T00019                                 

Gene name
elpc-3
Definition
Protein ELPC-3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CELE_ZK863.3 (elpc-3)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CELE_ZK863.3 (elpc-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(12179584..12179841,12179884..12180152,12180201..12180837,12180887..12181246,12181291..12181410))
Genome map
AA seq 547 aa AA seqDB search
MDQKGSQRALLAQTINEIVKLLIEAHNQKKDVNLNRLKCIVAQKNGLSFQPKLVDIIAGV
PSDYKDSLLPKLKAKPVRTASGIAVVAVMSKPHRCPHINFTGNICVYCPGGPDSDFEYST
QSYTGYEPTSMRAIRARYNPYLQTRGRLNQLMQLGHSVDKVEFIVMGGTFMSLPEDYRDF
FIRNLHDALSGHTSASVEEAVAYSERSKMKCIGITIETRPDYCLPRHLNDMLLYGCTRLE
IGVQSTYEDVARDTNRGHTVKSVCETFHMAKDTGYKVVIHMMPDLPNVGLERDKEQFLEL
FESPAFRPDGLKLYPTLVIRGTGLYELWKTGRYQSYPPSVLVDLIATILSLVPPWTRVYR
VQRDIPMPLVSSGVEHGNLREHAMAKMKELGLKCRDVRTREVGIQEIHNKVRPEDVELIR
RDYTANGGWETFISYEDPKQDILIGLLRLRKISDKAHRPELKGNVSVVRELHVYGSVVSV
ADRDPKKFQHQGYGSLLMEEAERIAREEHGSDKIAVISGVGTREYYRKLGYELDGPYMSK
MLDSAAA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaagggttcacaaagagcactactggcacaaacaataaatgaaattgtcaag
cttcttattgaagctcacaatcaaaaaaaggatgtcaacttgaatcggctgaaatgcatc
gttgctcaaaagaatggactgagttttcaaccgaaactcgttgacattatcgctggagtt
ccgtccgattacaaagacagccttcttccaaaactcaaggcaaaaccagttcgaactgct
tctggaattgctgttgtagcagtgatgagcaaaccacatcgttgtcctcacatcaatttc
actggaaacatttgtgtctattgtcccggtgggccagattctgatttcgagtattcaaca
caaagttacaccggttatgagcctacaagtatgcgtgcaattcgtgctagatataaccct
tatttgcaaactcgtggaagactcaatcaattgatgcaactcggacactcagttgataaa
gttgaattcatcgtaatgggaggaacatttatgtcgctgcctgaagattatcgagacttt
ttcattcgaaatctacatgatgcactgagtggacatacatcagcgtcagttgaagaagca
gtagcttattctgaaaggtctaaaatgaaatgtattggaatcactattgaaactcgtcct
gattattgtctaccccgtcatctgaacgatatgcttctctatggatgtacaagactagaa
atcggtgtccagtcgacctacgaagatgttgcacgtgatacgaatagaggtcatactgta
aaatcggtgtgcgagacatttcacatggcaaaggatactggatacaaagttgtcattcac
atgatgccagatctccctaatgttggtctagaacgagacaaggaacaatttctggaactt
tttgaaagtccagccttccgacctgacggtctgaagctgtacccaacattggtcattcgt
ggaacaggactatatgagttgtggaaaactggaagatatcaaagttatccaccatcagtt
cttgttgatttgattgctactatcttatcattagttccgccatggacacgtgtgtatcga
gtgcaaagagatatccccatgccattagtatcttcaggcgttgaacatggaaatcttcgt
gaacatgcgatggcaaaaatgaaagaactcggtttgaaatgtcgagacgttcgaacgaga
gaagttggaattcaagagattcataataaagttcgtcctgaagatgtggagctcattagg
cgagattacacagcaaatggtggttgggagacgtttatctcttatgaggatccgaaacaa
gacattcttattggacttcttcgattgagaaaaatttcagataaagcccatcggccagag
ttgaagggtaatgtgtcagtggttcgcgagttgcatgtatacggatccgtcgtttcggta
gcggatcgtgatcccaagaagttccagcatcaaggatacggttcacttttgatggaagaa
gctgaaaggatagccagagaagaacatggatccgataaaatcgcagtcatctcgggcgtt
ggaactcgagagtactaccgtaaacttggatacgagctggatggtccttatatgagcaag
atgctcgactctgctgcagcttaa

DBGET integrated database retrieval system