KEGG   Caenorhabditis elegans (nematode): CELE_ZK973.11Help
Entry
CELE_ZK973.11     CDS       T00019                                 

Gene name
ZK973.11
Definition
Protein ZK973.11
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CELE_ZK973.11 (ZK973.11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(4379496..4379625,4379675..4379813,4380214..4380850,4381181..4381301,4381357..4381434,4381483..4381574,4381624..4381770))
Genome map
AA seq 447 aa AA seqDB search
MQKYFLLPLLSLSVLLFVYDTEATNPPTAVLDLSDKFLDVKDEGMWFVEFYAPWCAHCKR
LHPVWDQVGHTLSDSNLPIRVGKLDCTRFPAVANKLSIQGYPTILFFRNGHVIDYRGGRE
KEALVSFAKRCAAPIIEVINENQIEKVKLSARSQPSYVFFGTSSGPLFDAFNEAASSKFS
VARFYSVAPPENDASFRQRVAVFKDNFEIEFNGDIEKLTEWVTRERWPGFLQATSSNLAE
IGASGKLVVLVVSSESHKFNNTSPIREFHKTAEEASKELRKHPDLWNRFQFAWLDGSDLA
SQIQMAAVSEPHLFIFNYTSYEYYLSEDEPSQMTIKSILTFLEQTSEGIDKETIVAFGGR
HLLTRIKRMAFELYWNIAQMFATQPLLSSCLFGVPIAFLSIICYSICSADFTVDRDEFYG
DEDELIDDEEGEETEHPETDDDHEKAE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatatttcttattaccgcttttaagcctctctgtactgttattcgtgtatgat
accgaagcaacaaatcctccaacagcagttctcgacttgagcgataaatttttggatgtg
aaagatgaaggaatgtggtttgttgaattctacgctccatggtgtgctcactgcaagcgc
cttcatccagtttgggaccaagttggacatacattgtctgacagcaatttacctatcaga
gtaggaaagctcgattgcacccgtttcccagcagttgccaataaattgagcattcaagga
tatccaacgattttgttcttccgaaacggccatgttattgactacagaggcggaagagag
aaggaggctctcgtcagttttgccaaaagatgcgctgcaccaatcatcgaagttataaac
gaaaatcaaattgaaaaagtgaagctctccgcacgttctcaaccatcatatgtcttcttc
ggtacatcttctggaccacttttcgacgcattcaatgaagcagcaagctcaaaattttca
gttgctcgtttctattccgttgctccaccagaaaatgatgcctcgttccgccaacgcgtc
gctgtattcaaagataatttcgaaatcgaattcaacggagacatcgagaaattgacagaa
tgggtaaccagagaaagatggccaggattccttcaagcaacttcttcaaatctcgctgaa
attggtgcaagtggaaagcttgtggtgttggtggtttctagtgaaagtcacaagtttaac
aacacaagccccattcgagaattccacaaaactgccgaagaagcatcgaaagagctccga
aagcatccagatctatggaatcgattccaattcgcatggctcgatgggtcggatctggct
tctcaaattcaaatggcagctgtctcggagccacatttgttcattttcaattacaccagt
tatgaatattatctgagcgaggatgagccaagtcaaatgacaatcaaatctattctgaca
tttttggaacagacttcagaaggaattgataaggaaactattgttgctttcggaggtcgt
cacttgttgacaagaatcaagagaatggctttcgaattgtactggaacattgctcaaatg
ttcgcaactcagccacttttatcgtcatgcctgttcggagtaccaatcgcatttctcagc
atcatctgctatagtatttgctccgctgatttcacagtggatcgtgatgagttctatggc
gatgaagacgaactgattgatgacgaggaaggtgaagaaacggaacatccggaaaccgat
gatgatcacgaaaaagctgagtga

DBGET integrated database retrieval system