KEGG   Caenorhabditis elegans (nematode): CELE_D2030.4Help
Entry
CELE_D2030.4      CDS       T00019                                 

Gene name
D2030.4
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
  KO
K03963  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    CELE_D2030.4 (D2030.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
I:complement(join(7581065..7581217,7581323..7581427,7581510..7581623))
Genome map
AA seq 123 aa AA seqDB search
MGTKLSVSLEGASTPETAPRVDRPPTFDPQYGFERPRKVREMKATWEEMEQWKLKPAQRD
YCAHHLISLMKCQTQNAPFAGHACDGERGAWDKCEYDDHIMRIKEFERERRLLQRQARKE
ATA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgggaactaaactgtccgtctcattggaaggagccagtacaccagaaaccgcgccacgt
gtcgacagaccaccaactttcgatcctcagtatggattcgagcgaccgagaaaggtccgc
gagatgaaggctacttgggaagagatggagcagtggaagttgaagccagctcaacgcgat
tattgtgctcaccacttgatttcactcatgaaatgccaaacccaaaatgcaccatttgcc
ggacacgcgtgcgacggagaacgtggagcttgggataaatgtgaatatgatgatcatatc
atgagaatcaaagaattcgaacgtgaacgacgattgcttcaaagacaggctcgcaaagaa
gccactgcttga

DBGET integrated database retrieval system