KEGG   Caenorhabditis elegans (nematode): CELE_R04F11.3Help
Entry
CELE_R04F11.3     CDS       T00019                                 

Gene name
R04F11.3
Definition
(RefSeq) Uncharacterized protein
  KO
K03504  
DNA polymerase delta subunit 3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CELE_R04F11.3 (R04F11.3)
   00240 Pyrimidine metabolism
    CELE_R04F11.3 (R04F11.3)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CELE_R04F11.3 (R04F11.3)
   03410 Base excision repair
    CELE_R04F11.3 (R04F11.3)
   03420 Nucleotide excision repair
    CELE_R04F11.3 (R04F11.3)
   03430 Mismatch repair
    CELE_R04F11.3 (R04F11.3)
   03440 Homologous recombination
    CELE_R04F11.3 (R04F11.3)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_R04F11.3 (R04F11.3)
DNA replication proteins [BR:cel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CELE_R04F11.3 (R04F11.3)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CELE_R04F11.3 (R04F11.3)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     CELE_R04F11.3 (R04F11.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
Ensembl: 
UniProt: 
Position
V:complement(join(12315125..12315276,12316127..12317031,12317080..12317180))
Genome map
AA seq 385 aa AA seqDB search
MVENFTSILDDVCDPLTLTNFIKQTSLPRSEATSILEDYVKSKGDPLWALYEISGAVDSS
EFTFLPAEAQIIKHVVVPESDLTDTKSKFSEVFSTCLHSIQRTNPKDTRVYGRSWADNDD
LKGKKLPEQLKPQKKSDSSNVKVEKEKSTEQKPTIEPSTSSKSAIETKKSSIAPPKKQGT
LSMFSKKTEKKTEKTEKSQSPVPQDQEKKNRKRPMIEVDESEELIKATKPKEKTPEKKPE
KLIISQDSDEFPSSREQSVEKEKSPPAKRKRVNDENKKAKKRLIVPDSDDEEQVPMEVEE
KKTETKTNSSLPEDRRRTTRIEKVVETYVDEDGYLVSKAVQKAVECSPQKASPEKPKPKV
ITAPAPGTKKAPKKNSMITSFFKKT
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaatttcacctcaatactcgatgatgtgtgcgaccctctgacactcacaaat
ttcataaagcagacatcactaccaaggtcagaagccacaagcatccttgaagattatgtg
aaatcaaaaggggatccgctatgggcactttatgaaatcagtggagctgttgattcgtct
gaatttaccttccttcctgctgaagctcaaatcataaaacacgttgttgttcctgaatcg
gatttgactgacacaaaatcaaagttttctgaggttttttcgacatgcttgcacagtatt
caacgtactaatccaaaagatacgcgtgtatatggacgttcatgggctgataatgatgac
ttgaaaggtaaaaaattgccagaacaattgaagccacaaaagaaatcggattcgtcaaat
gttaaagttgagaaagaaaaaagtactgagcaaaaaccaacaatcgaaccaagtacatcc
tcgaagtcagctattgagacgaagaaaagttccattgctccaccgaaaaaacaaggaact
ctgagtatgttttccaaaaaaactgaaaagaaaactgaaaagactgagaaatctcaatcc
cctgttcctcaagatcaagaaaagaaaaatcgtaaacgtcccatgatagaagtcgatgag
tctgaagaacttattaaggccactaaaccaaaagaaaagacaccagagaaaaaaccggaa
aaattgattatttctcaagacagtgatgaatttccatcatcaagagagcaaagtgtggag
aaggaaaagtcaccaccagcaaagcgaaaaagggttaatgatgagaacaagaaagcgaag
aagagacttattgtaccggattctgacgatgaagagcaagttccaatggaggtcgaagaa
aagaaaacggaaacaaaaacaaactcatctttgccagaagatagacggagaaccacacga
atcgaaaaggttgtcgagacatatgttgatgaagatggttatttggtatccaaggcagtt
caaaaggctgtagaatgttctccacaaaaagcatcacccgaaaagcccaaaccgaaagtg
ataactgctccagcacctggtacaaaaaaggcacccaaaaagaactcgatgatcacctcg
tttttcaagaaaacttag

DBGET integrated database retrieval system