KEGG   Cedecea neteri: LH86_16045Help
Entry
LH86_16045        CDS       T03337                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
cen  Cedecea neteri
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LH86_16045
   00500 Starch and sucrose metabolism
    LH86_16045
Enzymes [BR:cen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LH86_16045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3381508..3382917
Genome map
AA seq 469 aa AA seqDB search
MTLASRLPAILQAVMTGQPNALRDKHYPQWHHAPVTGLMNDPNGFTWFAGRWHLFYQWNP
LAADHKYKCWGHWSSADLMQWRHEPLALMPDEEYDRSGCYSGSAVDLEGRLTLCYTGNVK
FDDGSRTAWQCLAVENSSGGFDKTGPVLPLPAGYTGHVRDPKVWQHEGVWYMVLGAQDLR
KQGKVLLFSSPNMRDWENRGEIAGNGVHGLTDAGYMWECPDLFPLDGKHVLLCCPQGLVR
QNERFLNVYPAAYLIGDFNYATATFSHGDLNELDAGFEFYAPQTALAPDGRRLLVGWMGV
PDGEEMLQPTREQGWIHQMTCLRELTLNNGKLYQNPIAELASLREEEQRWQGQASQAPAL
DAKRLELQIEATGNFSLRFGGGLTLDVTGRGITLQRPGLASGEPHLRYWHGKVSSLQILC
DSSSVEIFINQGEGVMSSRYFPHPSERLSFNGESEVTLRYWSLRSCMIE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgcttcccgtttaccggccattttgcaggccgtgatgacaggccagcccaac
gccctgcgggataagcactatccgcagtggcatcacgccccggtgaccgggttgatgaac
gatccgaacgggtttacctggtttgccgggcgctggcacctgttttatcagtggaacccg
ctggcggcggaccataaatacaagtgctggggccactggagttcggctgatttaatgcag
tggcggcacgaaccgctggcgctgatgccggatgaagaatacgaccgcagcggctgctac
tccggcagcgccgttgacctcgaaggtaggctgacgctgtgttacaccggcaacgttaag
ttcgacgatggtagccgcacggcctggcaatgcctggcggtggaaaacagctcaggtggt
tttgacaaaacagggccggttttaccactgcctgcgggctacaccgggcatgtgcgtgac
ccgaaggtctggcaacacgaaggtgtctggtacatggtgctgggcgcgcaggatcttcgc
aagcagggcaaggtgctactgttttcttcgccgaatatgcgtgactgggaaaacaggggc
gaaatcgccgggaacggcgtccatgggctgactgacgcaggctatatgtgggaatgtccc
gatctcttccctctggacggtaaacacgtgctgctctgttgcccgcaggggctggtccgt
caaaatgaacgctttctgaatgtttaccctgcagcgtatctgatcggcgattttaattac
gcaacagcgacatttagccacggcgacttgaacgagctggatgccggctttgaattctat
gcgccgcaaacagcgctggcgccggacgggcggcgtttgctcgtcggctggatgggcgtg
ccggatggcgaggagatgctgcagccaacccgcgagcagggctggatccaccagatgacc
tgcctgcgggagcttacgcttaacaacggcaagctttatcagaatccgatagcggaactg
gcttcactgcgtgaagaagaacagcgctggcaaggacaggccagccaggctccggcgctg
gatgcaaaacggctggaactccagatagaggccacgggtaacttcagtctccgctttggc
ggcggcctgacgctggacgttaccgggcggggcattacgcttcagcgtccaggccttgcg
tccggcgaaccgcatttgcgttactggcacggcaaggtttcttccctgcagatcctttgc
gacagctcaagcgtcgagattttcatcaatcagggggaaggcgtgatgagcagccgctat
tttccacatccttcggagcggctctctttcaacggtgagtcggaggtcacgttgcgctac
tggtcgctgcgttcctgcatgatagaatga

DBGET integrated database retrieval system