KEGG   Crinalium epipsammum: Cri9333_0078Help
Entry
Cri9333_0078      CDS       T02373                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cep  Crinalium epipsammum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cep00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cep00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105457..106938)
Genome map
AA seq 493 aa AA seqDB search
MKLRELLETVPNLLETPNHPALDAEVKGLKTNSHACQAGDLFIGMPGTRVDGGEFWHSAL
ASGAIAAIVSPQAAQKHPIADACVISAADMTQACAAVATAFYGYPGRQLNLIGVTGTNGK
TTTTHLIEFLLNHQQHPTALFGTLYTRWSGYQETATHTTPFAVELQKQLADAIAAGCKMG
VMEVSSHALAQGRVLGCPFEVAVFTNLTQDHLDYHRDMEDYFAAKALLFSPEYLQGRAVI
NLDDDYGKRLIEKSPSEKIWSYSVNDSKADLWTSDLNYGQTGVSGMLHTPAGEMAFSSPL
VGQYNLENLLAAVGTILHLGLDLESVVQALPEFVGVPGRMERVQITPEQDISVIVDYAHT
PDSLENLLKAARPFIQGKMICVFGCGGDRDRTKRPLMGAIAAELADQVVVTSDNPRTEDP
EKILQDVLAGIPESVKPIVNSDRATAIQTAILEAKPGDGVLIAGKGHEDYQILGTEKIHF
DDREQARDALSKR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacgagagttactagaaactgttcctaatttgttggaaacgccaaatcatccg
gcgttggatgctgaagttaaaggcttgaaaactaattctcatgcttgtcaggcaggggat
ttgtttattgggatgccaggaactagggttgatggtggggagttttggcatagtgcttta
gcctctggtgcgatcgctgctatagtttccccacaagcagcacaaaaacatcccatagca
gatgcttgtgtgatttcagcagcagatatgactcaagcttgtgctgctgtagcgacggct
ttttatggctatccagggcgacagctaaatttgattggagttacgggtacaaatggcaaa
actactacgactcatttaattgaatttctgctaaatcatcaacagcatccgacagcttta
ttcggtacactatatacccgttggtctggttatcaggaaactgctacacataccacgccg
tttgcggtggaattgcaaaaacaattagctgatgcgatcgcggctgggtgcaaaatgggg
gtaatggaagttagttcccacgcgctggcgcaaggaagggtgttaggttgtccatttgaa
gtggcggtgtttaccaatttgacgcaagatcatttggactatcaccgcgatatggaagat
tattttgctgctaaagctttgctatttagccctgaatatcttcaaggtcgcgctgtaatt
aatttagatgatgattacggaaagcggttaattgaaaaatcaccctcagaaaaaatttgg
agttacagcgttaacgattctaaggcggatttgtggactagcgatctaaattatgggcaa
acaggtgtgagtggaatgctacacactcctgcgggtgagatggctttttcttcgccgttg
gtaggtcagtataatctggaaaacttacttgccgcagtggggactattttacatttaggc
ttggatctagagtctgtggtgcaagcgttaccagaatttgtgggggttccagggcggatg
gaacgggtgcaaataacgcctgagcaagatattagtgtgattgtagattatgctcatacg
ccggatagtttggagaatttgctgaaggctgcgcgaccgtttattcagggtaagatgatt
tgtgtgtttggttgtggaggcgatcgcgatcgcactaagcgtcctttgatgggtgcaatt
gcagccgaacttgccgatcaagttgtggtaacttctgataacccgcgtactgaagatcca
gaaaagattctgcaagatgttttagctggaatacctgagtcagttaaaccaatagtaaat
agcgatcgcgctactgcaattcaaacagctattttagaagcaaaacctggtgatggtgtt
ctaattgctggtaaagggcatgaagattatcaaatattgggaactgaaaaaatccacttt
gacgatcgcgaacaagcaagagatgctttaagcaaaaggtaa

DBGET integrated database retrieval system