KEGG   Crinalium epipsammum: Cri9333_0333Help
Entry
Cri9333_0333      CDS       T02373                                 

Definition
alpha/beta fold family hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cep  Crinalium epipsammum
Brite
Enzymes [BR:cep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Cri9333_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418476..419306
Genome map
AA seq 276 aa AA seqDB search
MKYVLNPGRLPSSDQPGIWTSKAIPSKAEPFDLGQPDAPYAVLCVHGLAGDPSAYRTLAQ
LLANAGFRVRVILLPGHGTQVEDLAKTPYEAWIKWFEKEFIALAEKHSAVHVVGHSMGGL
LGLDLATDQPAKLEKLVVAATPYSLPLWSGLAVQAFANKAVAKLVGTVPLLLGPGIRRRE
AKADVMGYKSMPVTAILQLEGLRLDVLKRLDQVSTRVLLLTAAHDRTISKDSGSLLAAAL
GNNVEEWINYPRSAHVLTEDFDRFKIAERIISFFQS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtactaaatcctggacggcttccttcatctgatcaacctggtatctggaca
tcgaaggcaataccctcgaaagctgaaccctttgatctaggtcagcctgatgctccttac
gcagtcttatgtgtacacggccttgcgggtgatccgtctgcgtatcgaacattagctcaa
ttattagctaatgctgggtttcgggtacgggttattttgttgccaggacatggcacacaa
gttgaagatttagctaaaacaccttatgaagcctggattaaatggtttgaaaaggaattt
atagctctggcagagaaacactcggctgtgcatgtagtaggccacagcatgggtgggctt
ttaggtcttgatcttgctaccgatcaaccagccaagctcgaaaaacttgttgttgccgca
acgccttacagcttaccgctctggtcaggtttggcagttcaagcattcgccaacaaagct
gtggcgaagttggtgggaactgtaccgttattgttggggccagggattcgacggcgtgaa
gctaaggcagatgtcatgggctataaatcaatgcctgtgaccgcaatattgcagttagaa
ggcctgcgtctagatgtcctaaagcggctagatcaagtttcaactcgcgtcttacttctg
actgcggcacatgacagaactattagcaaggatagcggttcacttctggctgctgccttg
ggtaataacgtagaagaatggattaattatccgcgaagtgcacatgttttaactgaagat
tttgatcgcttcaagattgccgaacgcatcatttctttttttcaaagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system