KEGG   Crinalium epipsammum: Cri9333_0468Help
Entry
Cri9333_0468      CDS       T02373                                 

Definition
(GenBank) maltooligosyl trehalose hydrolase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cep  Crinalium epipsammum
Pathway
cep00500  Starch and sucrose metabolism
cep01100  Metabolic pathways
cep01110  Biosynthesis of secondary metabolites
Module
cep_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cri9333_0468
Enzymes [BR:cep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cri9333_0468
Exosome [BR:cep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cri9333_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 Alpha-amylase_C DUF3459 AMPK1_CBM PBP_like
Motif
Other DBs
NCBI-ProteinID: AFZ11434
UniProt: K9VV46
Position
complement(539700..541562)
Genome map
AA seq 620 aa AA seqDB search
MVFSTANVTSGMSVIQVSTQTGMGAIPYEGGTAFRVWAPFASAIYVAGNFNNWSITENLL
APENNGYWSVDVPGAKEGQNYRYVIQSPFIPSDSVWWRTDPYCKHVLDNDGGDGVIVTDQ
FDWGTNTFNMPVWNELVIYELHIASFNRSENKPGDLNSIIDKLGILKDLGINAIELMPIF
GFPGEYSLGYNPAFPFDIESNYGDPGKFKNFVKKAHEFGIAVILDVVYNHFGDKELDYSL
RRFDGWNQNNGDGIYFYNDQRVQTDFGPRPDYGRGEVRQYIRDNALMWLEEYQIDGLRFD
STINIRNIYGKNNEPVNDIPEGWSLMQWINNEIDSKMPWKITIAEDLQNNEWINRNTGSG
GAGFDSQWGSFFYYSIFNAVVASTDSARNMYSVRDAILQRFETDAWKRVIYSENHDEVAE
INHKVRLPEAIWHGNADSWFARKRSTLAAALVFTSPGIPMIFQGQEFLEWGNWSDSGTLD
WSKKDKFSGIWDLYQSLIRLRRNWYNNTRGLRGQHVNVHHVNNNDKVIAFHRWDNGGLGD
DVVVIINMGDRFYDRYSLGFPGGGTWWVRFNSDWNGYSPDFGNHSGYDTFANQSNPNDSD
GMPFSANIGIGPYSVLILSQ
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggtattttctacagctaatgttacatcaggtatgtctgttattcaggtctctactcag
accggaatgggggctattccctatgaaggaggcacagcttttcgtgtttgggcgcccttt
gcttcagcaatttatgtagcaggaaattttaataactggtctataactgaaaatctactc
gcccctgaaaataatggatactggtctgtggacgttcctggagctaaagaaggtcaaaat
taccgctatgtaattcaaagtcctttcattcctagtgattctgtatggtggcgtaccgat
ccctattgcaaacatgtcctagacaatgacggcggcgatggtgtaattgtcacagatcag
tttgattggggaaccaataccttcaatatgccagtctggaatgaattagtgatttatgag
ctgcatatagcttcttttaatagaagcgagaacaagcccggagatttaaattcaattatc
gataaactaggtatcttaaaagacttaggcatcaatgcaattgaactgatgccgattttt
ggttttccgggagaatactctttaggctataaccctgctttcccctttgatatagaaagt
aattatggtgatcctggtaaatttaaaaacttcgtcaaaaaagcccatgaatttggcata
gctgtgattcttgatgtagtttataaccattttggtgataaagaactagactattctcta
cggcggtttgatggttggaatcaaaataacggggatggaatatatttttacaacgatcaa
cgcgttcaaaccgattttggtcctcgcccagactatggcaggggtgaagtgcggcaatat
atccgtgacaacgctttgatgtggctggaagaatatcagatagacggtttacgctttgat
tccaccatcaacattcgtaatatttacggcaagaacaacgaacctgtaaatgacattcct
gaaggctggagcttgatgcaatggatcaacaatgaaatagacagtaagatgccgtggaag
attacgatcgcagaagacttgcaaaacaacgaatggatcaaccgtaatacaggatctggg
ggagccggatttgattctcaatggggtagctttttttattattctatttttaatgcagtg
gtagcttccacggatagcgcccgtaatatgtacagcgttcgggatgcaattttgcaaagg
tttgaaaccgatgcttggaagcgagttatttacagcgaaaaccatgatgaagtagccgaa
attaaccacaaagtccggctaccggaggcaatttggcatggtaatgcagatagctggttt
gcccgcaaacgctctaccttagcagcggctctcgtcttcacatctcctggaattccgatg
atttttcaaggtcaagaatttttggaatggggaaattggagtgattctggcacattagat
tggagcaagaaagataaatttagtggtatttgggatctttatcagtcgctaattcgttta
cggcgcaactggtataacaacaccagaggtttgcgtggacagcatgtcaacgtacatcac
gttaacaataacgacaaagttatagcctttcatcgttgggataacggcgggctaggggat
gatgtagttgtgattataaatatgggcgatcgtttctacgatcgctatagcctaggcttt
cctggaggcggaacttggtgggtaaggtttaatagtgactggaatggttacagcccagat
tttggcaatcattctggttatgacacctttgcaaatcagagtaatcccaatgattccgat
ggtatgcccttcagtgccaatattggcattgggccttatagcgtcttgattctttctcaa
taa

DBGET integrated database retrieval system