KEGG   Crinalium epipsammum: Cri9333_0843Help
Entry
Cri9333_0843      CDS       T02373                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cep  Crinalium epipsammum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cep00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
946109..947161
Genome map
AA seq 350 aa AA seqDB search
MPTKEEILLNFDPNAIGVDNGNLLGLPFDYESANIIVFGVPWEVTVSYGVGTAAAPRVVL
DASRQLDIYDFDNPEGWKQGIFMYEIPEDIEQKGEVLRQQATKVIAHLEQGNNIADDLDI
ARLQQNIDREGQAVNQWLFNQATAAINKGKKVAVIGGDHSAPLGYMQALAAHYPEFGILH
IDAHADLRDAYEGFEFSHASIMFNALKLPQISKLVQVGIRDICQDEVNLIQNSGGRVSTY
YDFILKQKLYAGISWLELCKQMVAELPQQVYISFDVDGLDPKLCPNTGTPVPGGLELEQA
FCLFREVINSGREIIGFDVCEVGNSEWDGNVGARAVYKLCNLMGLSQSEN
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcctactaaagaagaaatcctgctaaattttgatcctaatgctatcggtgttgataac
ggtaatcttttaggacttccctttgattacgaatctgccaatattatcgtcttcggtgtt
ccttgggaagtcaccgtttcctatggtgtaggaacagccgccgcaccaagagtagtttta
gacgcatctcgccaactggatatttatgattttgataatcctgaaggctggaagcaaggt
atttttatgtacgaaatacctgaagatattgaacaaaaaggtgaggtattaagacagcaa
gctaccaaagttattgcacatttagaacaaggcaataatatagcagatgatttagatatt
gctcgactccaacaaaatattgatcgagaaggtcaagctgttaaccaatggctatttaat
caagctactgctgctataaacaaaggtaagaaagtagctgtaattggtggggatcatagt
gcgccgttgggatatatgcaagcattagcagcacattatcctgagtttggaattttacat
attgatgctcatgctgatttgcgggatgcttacgagggattcgagttttctcatgcttcc
attatgtttaatgcgctgaaattgccccaaatttctaagttagttcaagtaggaattcgt
gatatctgtcaggatgaagttaatttgattcagaactctggggggcgagtttctacttac
tacgattttatattgaagcaaaaactctatgctggaatttcttggttagaactttgtaaa
caaatggtggctgaattaccccagcaagtttatattagttttgatgttgatggattagat
ccgaaactttgccctaatactggaacgcctgtccctggaggtttggaattagagcaagct
ttttgtttgttccgtgaagttattaatagtggtagagagattattggttttgatgtttgt
gaagtgggaaatagtgagtgggatggtaatgttggggctagggctgtttataagctttgc
aatttaatgggattatcacaatcagaaaattaa

DBGET integrated database retrieval system