KEGG   Crinalium epipsammum: Cri9333_1623Help
Entry
Cri9333_1623      CDS       T02373                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cep  Crinalium epipsammum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cri9333_1623
Enzymes [BR:cep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cri9333_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1856886..1857725
Genome map
AA seq 279 aa AA seqDB search
MSTTEPLISNPEPAIANSQPPLAGKTILVTRSAGQSNQFSDRLKREGAMVIEMPTLEIGH
PSSWEALDSAIANLNTFDWLILTSANGVEYFFERLGAQGIYTYALANLKIAVVGKKTAAY
LKQHGLQADFIPPDFIADSLVENFPEQLAGKKVLFPRVETGGRELLVKQLTAIGAEVVEV
AAYESRCPQEISHEALEALQRQQVDIITFASSKTVKNFYQLVEQNGGVSLNGVAIASIGP
QTSETCHQLLGKVDLESREYTLEGLTQAIIQWAKPLNIV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaactgaacccttaatttccaaccctgaacccgcgatcgccaattctcaaccc
ccacttgcaggcaaaactattttggttacccgatcagcaggacagtcaaaccaatttagc
gatcgcctgaagcgagaaggcgctatggtgattgaaatgcctactctagaaattggtcat
ccttctagctgggaagccttggatagtgcgatcgctaacctcaacactttcgactggcta
attctcacttccgccaatggcgtagagtatttttttgaaagactaggggcgcaaggtata
tatacttatgccttagctaatctcaaaattgccgtagttggtaaaaaaacagccgcatat
ctaaaacagcatggtttacaagctgattttattccgccagattttatagcagattcctta
gtagaaaactttccagaacaattagcaggtaaaaaagttttatttcctagagtggaaaca
ggcgggagagaacttttagttaaacaattaacagctattggtgcagaagttgtagaagta
gcagcttatgagtctcgatgtccccaggaaatctcacatgaggctttagaagcacttcag
cgccagcaggtagatataattacttttgctagttccaaaacagtcaagaatttttatcag
ttggtagaacaaaatggcggtgtgtctttaaatggtgtggcgatcgcttcaattggtcct
caaacctcagaaacttgccatcagttattaggcaaagtagacctagaatcacgcgaatat
acattggagggattaacccaagctatcatccaatgggcgaaacccttaaatatagtttaa

DBGET integrated database retrieval system