KEGG   Crinalium epipsammum: Cri9333_1684Help
Entry
Cri9333_1684      CDS       T02373                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cep  Crinalium epipsammum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cri9333_1684
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cri9333_1684
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cri9333_1684
Enzymes [BR:cep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cri9333_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1927504..1928805)
Genome map
AA seq 433 aa AA seqDB search
MTQATKPLKAGTATFTSLSCKECGAEYEAKAIHVCEYCFGPLEVSYDYDAIRRHVTRESI
QSGPNSIWRYKSFLPVATDTPIDVGTGMTPLVRSNRLARRLGLKKLYIKNDAVNMPTLSF
KDRVVSVALTRAQELGFTTVSCASTGNLANSTAAIAAYAGLDCCVFIPADLEAGKILGTL
IYSPTLMAVQGNYDQVNRLCSEVANTYGWGFVNINLRPYYSEGSKTLGYEVAEQLGWELP
DHIVAPLASGSLFTKIYKGFQEFIKVGLVADKHVRFSGAQADGCSPIAEAFREERDFIKP
VKPNTIAKSIAIGNPADGVYAVDIARKTNGNIESVSDREIIEGMQLLAETEGIFTETAGG
TTVAVLKKLVEAGKIDPEESTVIYITGNGLKTQEAVQGYVGEPLTIEAKLDSFERALERS
RTLERLDWQQVLV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcaactaaacctctaaaagctggaacagcaacctttacatctcttagctgt
aaagagtgtggtgctgagtatgaagccaaggcaattcatgtatgtgagtattgttttggt
cctttagaagttagctatgactacgatgctatacgccgtcacgtaactcgtgaaagtatt
caatcaggaccaaattcaatttggcgctataagtctttcttaccagttgctactgataca
cctattgatgtgggaacagggatgactcccttagtacgctctaatcgtttggcacgtcgc
ctgggtctgaaaaagctttacattaaaaatgatgctgtcaatatgcccaccttgagtttt
aaggatcgggtggtatcagttgcactgactagagcgcaagaattaggattcactacagta
tcctgtgcaagtacaggtaatttagctaattctactgctgcgatcgcagcttatgcaggt
ttagactgttgcgtgttcattcctgctgacttggaagcaggtaaaattttgggtacttta
atctacagcccaactttgatggctgttcaaggaaactatgatcaagttaaccgcctctgt
tctgaggtagctaatacttatggttggggatttgtcaatatcaacttgcgcccctactat
tccgaaggttcaaaaactcttggttatgaagtagctgaacagctaggttgggagttgcca
gatcatattgttgctcctttagcctctggatctttgttcacaaaaatttacaaaggtttt
caagaatttattaaagttgggctggttgcagataagcacgtgcgttttagtggagcgcaa
gcagatggttgttctcctatcgctgaagctttcagagaagaacgggattttattaaacca
gttaaaccaaatactattgctaaatccattgcgataggtaatccagcagacggtgtttat
gctgtagatattgctcggaaaaccaacggtaatatagaatcagtgagcgatcgcgaaatt
attgaaggtatgcagctactagctgaaaccgaaggtatcttcaccgaaacggctggtggt
actaccgttgcggtattaaagaaactggtagaagcaggtaagattgatcctgaagaaagc
accgtaatctacatcactggcaatggactgaaaacccaagaagcagtgcaaggatacgtt
ggagaacctctgacaatcgaagccaagctagatagttttgaacgcgccttagaacgttct
cgcactttagaacgccttgactggcagcaagtcctcgtttaa

DBGET integrated database retrieval system