KEGG   Crinalium epipsammum: Cri9333_1968Help
Entry
Cri9333_1968      CDS       T02373                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cep  Crinalium epipsammum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cri9333_1968
Enzymes [BR:cep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cri9333_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2231601..2232227
Genome map
AA seq 208 aa AA seqDB search
MISYLKGTVASTHKRSSSRTILILEVNQIGYELQVPPHLTQQLPETGEVQVFTHQIIREE
QILLYGFASAAERDLFRQLVTVSGIGAQMAIALLDTLGLPELIQAIVTGNIRALVKTPGV
GNKTAERIALELKTKLKEWRNLSGIGTTKASAVPAPAILEDVEMTLLALGYSNEEVAQAL
QAISEDAFIAKSKNPEDWIRGAITWLSD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgatcagctatcttaaaggcacagtagctagtacccataagcggagtagcagtcgcact
attctaattttggaagttaaccaaatagggtatgaattgcaagttccgccacatcttacc
cagcagttaccagaaacaggtgaagttcaagtttttactcatcagataattagagaagag
caaatcttactgtatgggtttgcttctgctgcggagagagatttatttcgtcagctagta
accgttagtggtattggcgcacaaatggcgatcgcacttttagatacacttggattacct
gagttaattcaagcaattgtcactggtaatattcgcgccttagttaaaactccaggtgtc
ggtaataaaacagccgaacgaattgctttggaattaaaaactaagttaaaagaatggcga
aacttatctggaataggcacaacgaaagcttcggctgtacctgcacccgcaattttagaa
gatgtagaaatgactctacttgctttgggatattctaacgaagaagttgcccaagcactg
caagcaattagcgaagatgctttcattgccaaaagtaaaaatcctgaagattggattaga
ggtgcaattacttggctaagtgattaa

DBGET integrated database retrieval system