KEGG   Crinalium epipsammum: Cri9333_2346Help
Entry
Cri9333_2346      CDS       T02373                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cep  Crinalium epipsammum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cri9333_2346
Enzymes [BR:cep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cri9333_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2650769..2651950
Genome map
AA seq 393 aa AA seqDB search
MKAITLLGSTGSIGTQTLDIVSQNPDQFRVVGLAAGSNVTMLAQQIRQFQPEIVAICDED
KLAELKEAIADLNPQPIIVAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIKAGKDI
ALANKETLIAGAPVVLPLIEEYGVKLLPADSEHSAIFQCLQGVPAGGLRRILLTASGGAF
RDLPVEKLAQVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIDIVI
HPQSIIHSLIELQDTSVLAQLGWADMRLPILYAMSYPERIYTNWERLDLVKAGNLTFRAP
DHQKYPCMQLAYAAGRAGGLMPAILNAANEQAVALFLEEKIGYLDIARCIETACDRASAQ
NRPDPSLDDIIAADKWARQEVLAISQRLEIVSV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgattactcttcttggctccactggctcgataggcactcagactttagatata
gtttctcaaaaccccgatcaattccgcgttgtgggattagcggcaggaagcaatgtgaca
atgctggcacagcagattcgacagtttcaaccggaaattgtggctatctgtgatgaagat
aagttagcagaactgaaagaggcgatcgcagacctcaacccacaaccgattatagtggca
ggggaggcgggtgtaattgaagtagcaagatacggtgatgcccaaacagtagttacagga
attgtcggctgtgcgggtttgttacccacaattgctgctattaaagctggaaaagatatt
gctttagcaaataaggaaactttgattgctggtgcgcctgtagttttaccgcttatagag
gagtatggtgtaaaactattacccgcagattccgaacattcagcaatttttcagtgtctc
caaggagtccccgcaggtggtttgcgccgaattttgcttactgcttcggggggcgcattt
cgagatttacctgtagagaagttagcacaggtaaaagttgctgacgctttaaagcatcca
aattggtcaatgggtcgtaagattactgtagactctgcgactttaatgaataaaggttta
gaagtaattgaagcgcactacctatttggagtggattacgacaatattgatattgttatc
catccccaaagtattattcactctttgattgaattacaagatacttcagttttagcgcaa
ttaggttgggcggatatgcgcttgccaatactttatgctatgtcgtatcctgagcgaatt
tatactaattgggaaagactagatttagtcaaagctggtaatttaactttccgtgcgccg
gatcatcagaagtatccttgtatgcagttagcttatgctgcgggtagggcagggggttta
atgcctgcaatattaaatgctgcaaatgagcaagctgtggcactatttttagaagagaag
attggttatttagatattgctcgttgtatagaaacagcgtgcgatcgcgcatctgcccaa
aaccgccccgatcctagcctagacgacattatcgccgccgataaatgggcaaggcaagaa
gttttagcaattagtcaacggctagaaatcgtcagtgtttaa

DBGET integrated database retrieval system