KEGG   Crinalium epipsammum: Cri9333_2382Help
Entry
Cri9333_2382      CDS       T02373                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cep  Crinalium epipsammum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cep00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2690522..2691646
Genome map
AA seq 374 aa AA seqDB search
MSSTASSPSTSRRMVFPFTAIVGQEEMKLALLLNVIDPFIGGVMIMGDRGTGKSTTIRAL
ADLLPEIDVVVNDPFSSHPSDPDLMSDELRQQFLENPQPLPSTKKKVAMVDLPLGATEDR
VCGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVER
EGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPALRVQIVEQRAEFDQN
PPAFVEKYQPEQIEAQKQIVDAQQLLSSVKMDYDLRVKISEVCSELDVDGLRGDIVTNRA
AKALTALEGRQEVTVDDIRRVIALCLRHRLRKDPLESIDSGYKVEKVFSRVFGLELSSEE
NVAATANGVRPGGR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcgacagcctcatcgccctccacctctcggcgtatggtttttccgtttactgcc
attgtcggtcaggaagaaatgaaactggctctgctgctaaacgtgattgatccttttatt
ggcggggtcatgatcatgggcgatcgcggcactggtaaatctacaaccatccgcgcattg
gctgatttattaccagaaattgatgtggttgtcaatgacccattcagcagccatcccagc
gaccccgatttaatgagtgatgaactcaggcagcaattcttagaaaatccgcagccattg
ccatcaaccaagaaaaaagtagcaatggttgacttacctctaggtgctacagaagaccga
gtttgcggcacaattgacatcgaaaaagcattatctgaaggtgttaaagcctttgagcca
ggattgttagctaaagctaatcgtggcattttgtatgtagacgaagttaacctcctcgac
gatcacctagtagacgtactcctcgactccgcagctagtggatggaacacagttgaacgc
gaaggtatatccattcgccaccctgcccgctttgtgcttgttggttctggcaaccccgaa
gaaggcgaacttcgtccccaattgctagaccgctttgggatgcacgccgaaattcgtact
gtaagagaaccagctttaagagtacaaattgtcgaacaaagagcagaatttgaccaaaat
cccccagcttttgttgaaaaataccagcctgagcaaatagaagcacaaaaacagattgta
gacgcgcaacaacttttgtcatctgtgaagatggattacgatttgcgggtgaaaatatca
gaagtttgttcagaattggatgttgatggtttacggggcgacatcgttaccaaccgtgca
gctaaagctttaactgcactagaaggcagacaagaagtaacagtagacgatatccgccga
gtcatcgctttatgcctgcgccatcgcctgcggaaagatcctttagaatcaattgattca
ggatacaaggtagaaaaagttttcagccgcgtattcggattagaactatcctcagaagaa
aatgttgctgcaacagcaaatggagtccgtccaggcgggcgttaa

DBGET integrated database retrieval system