KEGG   Crinalium epipsammum: Cri9333_2403Help
Entry
Cri9333_2403      CDS       T02373                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cep  Crinalium epipsammum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cri9333_2403
Enzymes [BR:cep01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cri9333_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2710666..2714658
Genome map
AA seq 1330 aa AA seqDB search
MFTHVKSTIRHIAPDDIRGRSLLKVVYVVLEPQYQSALSAAVRSINKNHPQMAIEISGYL
LEELRDPENYADLKRDVEKANIFIASLIFIEDLAEKVVAAVEPHRDRLDVAVVFPSMPEV
MRLNKMGSFSMAQLGQSKSAIAQFMRKRKEKSGAGFQDGMLKLLQTLPKVLKYLPMDKAQ
DARNFMLSFQYWLGGSSENLENFLLMLADKYVFKGGEMRNFAALKYNEPVTYPDMGIWHP
LAPQMYEDAKEYFNWYNSRKDIPEDLKDPLAPCIGLVLQRTHLVTGDDAHYVAIVQEMEA
MGARVIPVFAGGLDFSKPIDVYFYDPLSKGQTAIVDTVVSLTGFALVGGPARQDHPKAID
SLKRLNRPYMVALPLVFQTTEEWQESDLGLHPIQVALQIAIPELDGAIEPIILSGRDGAT
GKAIALQDRIESVAQRALKWATLRRKPKLDKKIAITVFSFPPDKGNVGTAAYLDVFGSIY
EAMQALQHNGYDVQNLPASSKELMEQVIHDAQAQYSSPELNVAYRMSVPEYEELTPYSQR
LEENWGPPPGNLNSDGQNLLVYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAA
YYTYLERIWKADAVLHFGTHGSLEFMPGKQMGMSGECYPDNLIGSIPNLYYYAANNPSEA
TIAKRRSYATTISYLTPPAENAGLYKGLKELSELIASYQTLKDTGRGIPIVNTIMDKCRI
VNLDKDINLPETDAKDMDSEERDTIVGNVYRKLMEIESRLLPCGLHVIGKPPTAEEAIAT
LVNIANLDREEENILSLSRIIANSLGRNIDEVYQGSDRGVLEDVQLLQDITLACRAAVAA
LVKEQTDADGRVSLVSKLNFFNMGKKEPWIEALHQAGYPKVDPEAIKPLFEYLEFCLKQV
CADNELGALLRGLEGEYILPGPGGDPIRNPDVLPTGKNMHALDPQSIPTEAAVKSAKIVV
DRLLARQKLDNGGNWPETIACVLWGTDNIKTYGESLAQIMWMIGVKPVPDALGRVNKLHL
IPLEELGRPRIDVVINCSGVFRDLFINQMNLLDQGVKMAAEADEPLEMNFIRKHALLQAE
EMGINLRQAATRVFSNASGSYSSNINLAVENSSWESESELQEMYLNRKSFAFSADNPGMM
GESRKIFESALKTADATFQNLDSSEISLTDVSHYFDSDPTKIVETLRGDGKKPASYIADT
TTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAVD
NWVYEDANSTFIKDEEMCKRLMNLNPNSFRKMVSTLLEVNGRGYWETSEDNLDRLRELYQ
EVEDRIEGIE
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgttcactcacgtcaagtccaccattcgccacatagccccagatgatattaggggcaga
tcgttacttaaggtggtctatgtcgtgctagagccgcagtaccagagcgccctctcagca
gccgttcgctcaattaataagaaccacccacagatggctattgaaattagtggctatctg
ctagaagaacttagagatcctgaaaattatgcagatttaaagcgggatgtagaaaaagcc
aatatattcatagcttcactaatttttattgaagacttagctgaaaaggttgtagcagca
gtagaaccccaccgcgatcgccttgatgttgcagtcgtcttcccctctatgccagaggtg
atgcgcctgaataagatgggtagcttctcaatggcacaattagggcaatctaagagtgcg
atcgctcaattcatgcggaagcgcaaggaaaaatctggtgctggcttccaagacggaatg
ctgaagctgttgcaaaccctgcctaaagtcctgaaatacctcccaatggacaaagcgcag
gatgccagaaacttcatgctaagtttccaatattggttgggtggttcctctgaaaacctc
gaaaacttcctgctgatgctggcagataaatatgttttcaaaggtggagagatgcgaaat
ttcgcggctctcaaatacaatgaacccgtaacttacccagatatgggcatctggcatcct
ttagcgcctcaaatgtatgaggatgctaaagaatatttcaactggtacaacagccgtaaa
gatattccagaagatttaaaagatcctcttgcgccttgcatcggtttagtattgcaacgc
acccacctagttacaggtgatgatgctcactatgtggcgatcgtgcaagaaatggaagcg
atgggcgcacgggtaatacctgtgtttgcaggtggtttagacttctccaaacccattgat
gtttatttctacgatccactttctaagggacaaaccgctattgtagatacagttgtatct
ttaactggatttgccttagtaggtggccctgctagacaagatcatccgaaagcgatcgac
tctttaaaacgcttaaatcgtccttacatggttgccctgcctttggtattccaaactacg
gaagaatggcaggagagtgatttaggattgcacccaattcaagtagcattacaaattgcg
attcctgaattagatggggcaattgagccgattattttatctggaagagatggcgctact
ggaaaagcgatcgcacttcaagaccggatcgaatctgtcgctcaacgcgccttaaaatgg
gcaacactacgccgcaaaccaaaattagataaaaaaattgccattaccgtttttagcttc
cctccagataaaggtaatgttggtacggctgcttacttagatgtatttggttccatctat
gaagcaatgcaagcattgcaacacaacggttatgacgtgcaaaacttacccgcgtcatcc
aaagaattgatggaacaagtcatccatgacgcgcaagcacaatatagcagcccagaatta
aacgtagcttaccggatgtcagtaccagaatatgaagaactgacaccttattcgcagcgt
ttagaagaaaactgggggccaccgcctggaaatctcaacagcgatggacaaaacctgcta
gtttatggtaagcaattcgggaatgtctttatcggcgttcagccaacatttggttatgaa
ggcgacccgatgcggttgttattctctcgttctgcgagtccccatcacggttttgcagct
tactacacatatttagaaagaatttggaaagctgatgctgtgctacatttcggcacacac
ggttctttggaattcatgcctggtaagcaaatggggatgtctggagagtgttatccagat
aacttaattggttcaattcccaatctttattactacgcagcaaataaccccagtgaagcg
acaattgctaaacgtcgcagttatgcaacaaccatctcctatttaactccacctgctgaa
aatgctgggttgtataaggggttaaaagaactcagcgagttaattgcttcttatcaaacc
ttgaaagataccggacgtggtatccccattgttaacaccatcatggataagtgtcggata
gtgaatctggataaggatattaacctgccagaaaccgacgcgaaggatatggatagtgag
gaacgggataccatcgttggcaatgtgtaccgcaagttaatggagattgaatcgcggttg
ttaccttgtgggttgcacgtaattggtaaaccgccaactgctgaggaagcgatcgcaact
ctcgtcaacattgctaatctagatcgagaagaagaaaatattctcagtctttcccgcatc
atcgccaatagtttagggcgtaatattgacgaagtatatcaaggaagcgatcgcggcgta
ttagaagatgtccaacttctccaagacattaccctcgcttgtcgcgctgctgttgctgct
ttagtcaaagaacaaaccgacgcggatgggcgtgtttccttagtttccaagttgaacttt
ttcaacatgggtaaaaaggaaccttggattgaagcattacatcaagcaggttatcccaaa
gttgacccagaagcgattaaaccgctatttgaatatctggaattttgcctcaaacaagtt
tgtgcagataacgaacttggcgcattactgcgaggattagaaggcgaatatattctacca
gggccaggaggcgaccccatccgtaaccctgatgtcttacctacaggtaagaatatgcac
gccctcgacccccaatctatccccaccgaagcagcagttaaatccgccaaaatagttgta
gaccgactattagcgcgtcaaaaactggataatggcggcaactggcctgaaactatcgcc
tgtgtactttggggaacagacaacatcaaaacttacggtgaatctctcgcccaaatcatg
tggatgattggtgtaaaaccagtaccagacgcattaggacgggtgaacaaattacaccta
attcccttagaagaattaggtcgtcctcgcattgatgttgtaattaactgttcaggtgta
ttccgcgacttgttcatcaaccaaatgaacttgcttgaccaaggtgtgaaaatggcagca
gaagcggatgaacccttagaaatgaacttcatccgcaaacacgcattgctgcaagcagaa
gaaatgggtattaacctgcgtcaagctgcaactcgcgtgttctctaatgcttccggttct
tattcttctaacatcaacctagcagtagaaaacagcagttgggaaagcgaatctgagtta
caggaaatgtacttaaatcgcaaatcttttgcctttagtgcagataatccaggcatgatg
ggagaatcacggaagatatttgaatcagcattaaaaacggctgatgctacattccaaaac
ttagattcttccgaaatcagcttaaccgacgtttctcactatttcgactccgaccccaca
aaaattgttgaaactttacggggtgacggtaaaaaaccagcatcttatattgctgacact
actaccgctaacgctcaagttcgtaccttatcagaaaccgtgcgtttagatgcccgtacc
aagttacttaatcctaagtggtacgagggaatgttaagtcatggttatgaaggtgtgcgc
gaactttcaaagcgtttagttaatactatgggttggagtgcaactgctggcgctgttgat
aactgggtgtatgaagatgcgaatagcacctttatcaaagatgaggaaatgtgtaagcga
ttgatgaatctcaatcccaattctttccgcaagatggtatcaactttgttggaagtgaat
gggcgcggttattgggagactagcgaggataatttagatcgtttgcgcgagttgtatcaa
gaggttgaggacagaatcgaaggaattgagtaa

DBGET integrated database retrieval system