KEGG   Crinalium epipsammum: Cri9333_2503Help
Entry
Cri9333_2503      CDS       T02373                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cep  Crinalium epipsammum
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cep00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2810878..2811651
Genome map
AA seq 257 aa AA seqDB search
MQQQNISKLPSMRLITIPISHYCEKVRWALDWLEIPYTEERHVPFFHRLATSRDGGKSVP
VLVTQDGTFTDSTDILHYLDTKNTKSKKLYPSEPNLRNEVNQLEELFDTRLGNNIRRWGY
FYRIHDREGIRRSWCTGTPGWEKAGFAIAFPVMRKIVQRTYNITAVSARDSLQEIQQIFE
IVNKKLSDARPYLIGDNLSAADITFAALVAPALLPPEHPIKPPALETFNNQEMITTIKEL
RATPAGVYALRLYREQR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacaaaatattagtaaattacccagtatgcgattaattactatcccaatcagc
cattattgtgaaaaagtacgatgggcattagattggttagaaattccatatactgaagaa
cgtcatgtacccttttttcatcgactagcaacttctcgtgacggcggaaaaagtgttcca
gtgttagttacccaagacggaacctttactgattcaacagatattttgcattacttagat
actaagaatacaaaaagcaaaaaactttatccgagtgaaccaaatcttcgcaacgaagtt
aatcagttagaagaactttttgatactcgactaggaaataatattcgacgttggggatac
ttttatcgtattcatgatcgtgaaggaattcgccgttcttggtgtacaggaactcctggg
tgggaaaaagcaggatttgcgatcgcatttcctgtaatgcgaaagatagtgcaacgaaca
tataacattacagccgtttctgctagagattccttgcaagaaattcagcagatttttgaa
atagtcaataaaaaactatccgatgcgcgtccttacctcataggcgataatttatcagca
gcagatataacttttgccgctttagttgcccccgcattactacctccagaacaccccata
aaaccacctgcacttgaaacatttaataatcaagagatgatcacaactattaaagagtta
agagcaactcccgccggagtttacgcactacgtctttaccgagaacaacgttag

DBGET integrated database retrieval system