KEGG   Crinalium epipsammum: Cri9333_2505Help
Entry
Cri9333_2505      CDS       T02373                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cep  Crinalium epipsammum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cri9333_2505
Enzymes [BR:cep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cri9333_2505
Exosome [BR:cep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cri9333_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2812324..2813973
Genome map
AA seq 549 aa AA seqDB search
MAPIEFNLFAPYNNGAALIGTFSDWKEVPMKKGEDGYFRTAIELEDGVYQYKFKVQSKSW
FFEEDQWVEVVDPYATDIDNPTQNGVVRIKDGERIVDTYVWQHDDKPLPADHELVIYEMH
VGDFSGGEDDPFARGKYKHAIEKLDYLCDLGINAIELMPVKEYPGDHSWGYNPRYFFATE
SSYGTTEELKKLIDECHGRGIRVLMDGIFNHSEAESPLTQIDHDYWYHHSPRDPENNWGP
EFNYEFYDENLETYPARKFVGDSVRFWIQEYHIDGIRYDAARQIANYDLMHWLVQEAKQA
ASMKPFYNIAEHIPETTSITNVDGPMDGCWHDSFYHCVLEHICGDTFDLERLKDVLDAKR
QGFMGATNIVNYLTNHDHNHVMAELGEREIFDEEAFRRAKLGAVLLMTAMGVPLIWMGEE
FGEYKYKTPDQAKIEWTLLKNDLNSGLLDYYKGLIALRKNNHALYTENIEFFHENPEAKV
LAYTRWNDEGSRLVVVANFSDQFLGGYSVPGFPENGTWHEWTYDHNVEVGDNNLITDLGE
YEAKVFVWH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtggctcccattgaatttaacttatttgctccttataacaacggagccgctttaatcggg
acattttccgattggaaagaagttcccatgaaaaaaggggaagatggttattttcgcaca
gcaattgaactagaagatggcgtttatcaatataaatttaaagttcaatctaaatcttgg
ttttttgaagaagatcaatgggtagaggtggtagatccttatgctactgatattgataat
ccgacacaaaacggcgtagtacggattaaagatggtgaaagaatagttgatacttatgtt
tggcagcatgatgacaaacccttgcctgccgaccatgaattagtgatatatgaaatgcac
gttggggacttctccggtggtgaagatgatccctttgctcgtggtaaatataaacacgct
attgaaaaattagattatctttgtgacttaggtattaacgcgattgaattaatgcctgtc
aaagaatatccaggggatcacagttggggttataacccacgttatttctttgcaacagag
tctagctatggcactacagaagagttaaaaaagctaattgatgaatgccacggacgaggt
attcgtgtattaatggacgggatttttaaccactcagaagcagaaagtcccctcacccaa
attgatcatgattactggtatcatcactcaccgcgtgatcctgaaaacaattgggggcca
gaatttaattacgaattctacgacgaaaacttagaaacatatcctgcccgtaaatttgtt
ggtgatagcgttcgcttttggattcaagaatatcatattgacggcattcgctacgacgct
gcaagacaaattgctaactacgacctcatgcactggctagtccaagaagctaaacaagct
gcaagcatgaagcctttttataacattgctgaacacatccctgaaacaaccagcattact
aatgttgatgggccaatggatggttgctggcatgatagcttttatcactgtgttttagaa
catatttgtggtgatacttttgatttagaacgtctcaaagatgttcttgatgccaagcgt
caaggttttatgggggcaactaatatagttaactacctgacaaaccatgaccataaccat
gtcatggcagaattgggcgaacgtgagatttttgatgaagaagcatttagacgtgcaaaa
ttaggtgcagtattgctaatgacagcaatgggagtgccattaatttggatgggtgaagaa
tttggtgagtataaatacaaaactcccgaccaagctaaaattgaatggactttgttaaaa
aatgacctaaatagtggtttgttggactattacaaaggtttgattgcgctgcgtaaaaac
aatcatgccctctacacagaaaacattgaatttttccatgaaaaccccgaagcaaaagtg
cttgcctacactcgttggaatgatgaaggttcacgtttagtcgtagtggcaaatttctcg
gatcagtttttaggtggttattcagtaccaggttttccagaaaatggaacttggcatgag
tggacttacgaccataatgttgaagttggagataacaacctcataactgatttaggagag
tacgaagctaaggtttttgtctggcactaa

DBGET integrated database retrieval system