KEGG   Crinalium epipsammum: Cri9333_2650Help
Entry
Cri9333_2650      CDS       T02373                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cep  Crinalium epipsammum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cri9333_2650
Enzymes [BR:cep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cri9333_2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2969852..2971072
Genome map
AA seq 406 aa AA seqDB search
MTPTPTTIAPLSWSQLETLTDYQVDTVNGLTNAQACLRLFGMSESDVRVTLYRDNHAWCP
YCQKVWLWLEEKQIPYRIKKVTMFCYGEKESWYKRIVRSGMLPALELDGRMITESDDILL
ALEQAFGALAFSMEDPKVIPLRRLERLLFRAWCSWLCYPTRSSREEQHNRDQFKAVVAKV
EEALGSTPSPYFLDGFSTVDVIFTPYVERMNASLYYYKGYSLREENPRLSDWFEAMESRP
TYRGTQSDFHTHVHDLPPQMGGCWENGEPQMLINKAKVDHGSWFGLPDVTYPEPETSRKE
ALHRVLKHRANIIRVNPADDKLFDEALRCALTYLMTGEVCTPPSGSDVALRYLRDRINVP
RDMSIYAAKRLREALEAIAAIAGDNQSTPIPFNHRRDQNPANFARI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacacccacccccacaacgatcgcacccttaagctggtcacaactagaaacccttaca
gattatcaagtagataccgtcaatgggcttaccaatgctcaagcttgtttgcgcttattt
ggcatgagcgaatctgatgtacgggtaactctataccgcgacaaccacgcctggtgtcct
tactgtcaaaaagtctggttgtggctggaggaaaagcaaattccttaccgcatcaaaaaa
gtaacaatgttttgctacggcgagaaagaaagctggtataaacgtatagtgcgatcgggt
atgttaccagcccttgagctagacggtcgcatgatcaccgaaagtgatgatattttgctc
gccttggaacaagcctttggcgctttagcttttagcatggaagaccccaaagtaatacct
ctacggcggttggagcgacttttatttagagcttggtgttcctggctttgctatcctaca
aggtcttctagggaagaacagcataaccgagaccaattcaaagcagtagtagctaaggta
gaagaagctctaggcagtactcccagcccttattttttggatgggttcagcactgtagat
gtaatatttacgccctatgttgagcgcatgaatgccagtctttactactacaaaggctac
tcattacgggaggaaaacccgcgtttatcagactggtttgaggctatggaaagccgaccg
acttatcgcggtactcagagcgactttcatacccacgtacatgatttaccaccccagatg
ggaggatgctgggaaaatggcgaacctcaaatgctgattaataaagcaaaggtggatcat
ggttcctggtttgggctacctgatgtaacttaccctgaaccggaaacttcccgtaaggaa
gcactacaccgtgtacttaagcaccgcgccaatattattcgagtaaatcccgccgatgac
aaattatttgatgaagctttgcgttgtgctttaacttatctgatgactggggaagtttgt
acgccgccatcgggttctgatgttgctttgcgatatttgcgcgatcgcattaacgtacct
agagatatgtctatctacgcagcaaaacgactcagggaagctttagaagcgatcgcagca
atagctggtgataatcagagtacccccattccctttaaccatcggcgcgatcaaaaccca
gctaattttgctaggatttag

DBGET integrated database retrieval system