KEGG   Crinalium epipsammum: Cri9333_3030Help
Entry
Cri9333_3030      CDS       T02373                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cep  Crinalium epipsammum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cep00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3408838..3409335
Genome map
AA seq 165 aa AA seqDB search
MNLGQDYKRCAIALGSNLGDSNTILKSALFTIANTPGVNLISQSSFYQTVPIGPPQPTYL
NACAILEVKLNPDELLEKLLKIELEFGRVRTEYWGARTLDLDILLFDDLIWDTPTLQIPH
PRMGERGFVLVPLAEIAPSWIEPRSGIAIAELLQAVDCSGVLGVI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaggacaagattataaacgttgtgcgatcgcacttggtagcaatttgggtgac
tctaataccatccttaaatctgcactcttcactattgctaacactccaggtgttaactta
atatctcagtcgagtttttatcaaactgtgcctattggtccaccgcaacccacttattta
aatgcttgtgcaattttagaagttaagttaaatccagatgagttattagaaaagttatta
aaaattgaattagaatttgggcgtgtgcgtacagaatattggggtgctagaactctcgat
ctcgatatcttattatttgatgatttaatctgggatacgccgactctccaaatacctcat
ccgcgtatgggggagagagggtttgttttagtaccgttggctgaaattgcgccaagttgg
attgaaccgaggtcaggaattgcgatcgcagaactcttacaagcggtagactgttctggt
gttcttggagttatataa

DBGET integrated database retrieval system