KEGG   Crinalium epipsammum: Cri9333_3443Help
Entry
Cri9333_3443      CDS       T02373                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cep  Crinalium epipsammum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cri9333_3443
Enzymes [BR:cep01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cri9333_3443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3854896..3856947)
Genome map
AA seq 683 aa AA seqDB search
MPAPTTNPTITAFPLTAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARALHSL
LPPIEVVKGSISNCDPNNPSEWDDDLLSQAHNSPSINGDNEVDLPTEVIPAPFVQIPLGT
TEDRLIGSVDVEKSVKLGETVFQPGLLAQANRGVLYIDEINLLDDQIANLLLTSLTEGRN
QIEREGISFQHPCKPLLVATYNPEEAPLREHLLDRIAITLSADGVLGLDERVQAVDQAIE
YSRSPQAFLEQYDEEIDNLKTQILLAREWLKDVQITRDQIAYLVNEAIRGGVQGHRAELF
ALRVAKAAAALDGRNKVNADDLRRAVELVIVPRATVVQTPPEETPPPPPPPPQPQDQSPQ
EQDQQEDQEEEEDNSEQQEQEAPDIPEEFIFDPEGVIIDEDVLYFAQRSQRQGKSGSRSL
IFSEDRGRYVKPVLPKGKVRRIAVDATLRAAAPYQKSRRERQPNRKVIVEQGDIRGKRLA
RKAGALVVFVVDASGSMALNRMQSAKGAVMRLLTEAYQNRDQVALIPFRGEQAEVLLPPT
RSIALAKSRLERLPCGGGSPLAHGLTQAVRVGMNAQMSGDVGQVVIVAITDGRGNIPLAR
SLGEPIPEGEKPDIKAELLDIATKVRGVGIQLLVIDTENKFISTGFAKELAKQAGGKYYH
LPKATDQAIAQVTMGAIADLKSR
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccctactactaaccctacaattactgcctttcccttaactgcggttgtggga
caagaagccatcaaaatagcgttgctgttagcagcagttgatccagggctgggaggggtg
gcgatcgcaggtcgtcgcggtactgccaaatctgtgatggcacgcgccctgcactcttta
ctccctcccatcgaagtagtcaaaggttccattagcaactgcgatcctaataaccccagt
gagtgggacgacgacctgttatcacaagctcacaactccccctccatcaacggagataat
gaagttgacctccccacagaagttatccctgccccgtttgtgcaaattcctttgggaacc
acagaagacagactaataggttctgtagatgtagaaaagtctgtcaaacttggagaaaca
gtatttcaacctggattattagcgcaagcaaatcgtggtgttttatatatagatgaaatt
aacctgctagatgaccaaattgctaatttgctgctcacaagcttaactgaagggcgtaat
caaattgagcgcgaaggcattagttttcagcatccctgcaagccgttattagttgccact
tataacccagaagaagccccactgcgagaacatttactcgatcgcattgcgattacactt
tccgcagatggtgtattaggtttggatgaacgagtacaagctgtagatcaagcaatagaa
tactctagatctccccaagcatttttagagcaatacgacgaagaaattgataatctcaaa
acccaaattctcttagcgcgagaatggctcaaagatgtccaaattactagggatcaaatt
gcctatctagtcaatgaagcgattcgtggaggtgtgcaaggacatcgcgcagaactattt
gctttgcgggtagcgaaagcagcagcagctttggatggacgtaataaggttaatgctgac
gatttgcgtcgggctgtagagttggtaattgtacctagagcaacagttgtacaaacaccg
ccagaagaaacaccgccaccacctccgccaccaccacaaccccaagatcaatctccacaa
gaacaagatcagcaggaagatcaagaagaggaagaagataattctgaacaacaagaacaa
gaagcacctgatattcccgaagaatttatcttcgatccagaaggtgtgattattgatgag
gatgtactttattttgcacagcgatcgcaaagacaaggcaaatctggtagtcgtagttta
atcttttctgaagatcgcggacgttacgttaaaccagtattacctaaaggtaaagtaagg
agaattgcagttgatgctactctccgcgctgctgcgccttatcaaaaatctcgccgtgaa
cgtcaaccaaatcgtaaagttattgttgaacaaggtgatattcgcggaaagcggttagct
agaaaagcaggtgcgttagttgtatttgtagttgatgcttctggttcaatggcgcttaat
cggatgcaatcagcgaaaggtgcagtcatgcgcctactgacagaagcttatcaaaaccgt
gaccaagtagcattaattccatttagaggagaacaagcagaggtacttttaccccctact
cgttcaattgctttagctaaatcacgtttagaacgtttaccttgtggcggtggttcacct
ctagcgcatggtttaacgcaggcggtgcgcgttgggatgaatgctcaaatgtccggtgat
gttggtcaagttgtgattgtggcaattactgatggacgaggtaatattcctttagctcgt
tctttgggtgaaccaatacctgaaggagaaaagccagatatcaaagcagaattgttagat
attgctacaaaagttcgtggcgtaggcattcagcttttggtaatagatacggagaataag
tttatttctactgggtttgctaaggaattagcaaaacaagcaggaggtaagtattaccac
ttacctaaagctaccgatcaagcgatcgcgcaagttactatgggtgcgatcgctgatcta
aaatctcgctag

DBGET integrated database retrieval system