KEGG   Crinalium epipsammum: Cri9333_3574Help
Entry
Cri9333_3574      CDS       T02373                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cep  Crinalium epipsammum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cep01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cep00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4001598..4002485
Genome map
AA seq 295 aa AA seqDB search
MQIRRRHPNPSVSITTLRYEVKVPDAEPRHILEKIVWQKETEVDQMRERLPLIKLQQQVK
AAPPVRNFREALRQGKTKPALIAEVKKASPSKGVIREDFDPVAIAQAYQQGGASCLSVLT
DKVFFQGSFENLALVRKSVDLPVLCKEFIIYPYQIYLARSYGADAILLIAAILSDQDLQY
FIKIAKALSMTALIEVHTAEELERVLALEDVNLIGINNRNLEDFSVDLQTTCQLLSSNSS
QLQERDILVVSESGLHTPEDIKLVSDAGASAVLIGESLVKQPDPASAIATLFAYK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgaagaagacatccgaatccgtcagtttctatcactaccttgcgctacgaa
gttaaagtaccagatgctgaaccaagacatattttagagaaaattgtctggcaaaaagaa
acagaagttgatcagatgcgggaacgtcttcccctgatcaagttgcagcaacaagttaaa
gcagcaccacctgtgcgtaattttagagaagcattacgacagggaaagactaagccagct
ttaattgcagaagtaaaaaaagcttctcctagtaagggagtaattcgagaagattttgat
cccgtagcgatcgcacaagcctaccagcagggaggagcaagctgtttgtcagtacttact
gacaaagtattttttcaaggcagctttgaaaacttggctctagtgcgtaagagcgtagac
ttaccagtgctgtgtaaggaatttatcatctatccttaccaaatatacttagctcgcagt
tatggggctgatgctatcctcttaatcgcagctattcttagcgatcaagacttgcagtat
tttatcaaaattgccaaagccttgagtatgactgcattgattgaagtacatacagcagag
gagctagagcgagtattagcattggaagatgttaacctgattgggattaacaatcgcaac
ttagaagatttttcagttgatttgcaaacaacctgtcaacttttgagtagcaatagcagc
caattacaggagcgggatatcttagttgttagtgaatctgggttacatactccagaggac
attaaattagtgtctgatgctggtgctagtgctgttctcattggtgagtcattggtgaaa
caacctgatccggctagtgcgatcgctactttgtttgcctataaataa

DBGET integrated database retrieval system