KEGG   Crinalium epipsammum: Cri9333_3574Help
Entry
Cri9333_3574      CDS       T02373                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cep  Crinalium epipsammum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cri9333_3574
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cri9333_3574
Enzymes [BR:cep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cri9333_3574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4001598..4002485
Genome map
AA seq 295 aa AA seqDB search
MQIRRRHPNPSVSITTLRYEVKVPDAEPRHILEKIVWQKETEVDQMRERLPLIKLQQQVK
AAPPVRNFREALRQGKTKPALIAEVKKASPSKGVIREDFDPVAIAQAYQQGGASCLSVLT
DKVFFQGSFENLALVRKSVDLPVLCKEFIIYPYQIYLARSYGADAILLIAAILSDQDLQY
FIKIAKALSMTALIEVHTAEELERVLALEDVNLIGINNRNLEDFSVDLQTTCQLLSSNSS
QLQERDILVVSESGLHTPEDIKLVSDAGASAVLIGESLVKQPDPASAIATLFAYK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgaagaagacatccgaatccgtcagtttctatcactaccttgcgctacgaa
gttaaagtaccagatgctgaaccaagacatattttagagaaaattgtctggcaaaaagaa
acagaagttgatcagatgcgggaacgtcttcccctgatcaagttgcagcaacaagttaaa
gcagcaccacctgtgcgtaattttagagaagcattacgacagggaaagactaagccagct
ttaattgcagaagtaaaaaaagcttctcctagtaagggagtaattcgagaagattttgat
cccgtagcgatcgcacaagcctaccagcagggaggagcaagctgtttgtcagtacttact
gacaaagtattttttcaaggcagctttgaaaacttggctctagtgcgtaagagcgtagac
ttaccagtgctgtgtaaggaatttatcatctatccttaccaaatatacttagctcgcagt
tatggggctgatgctatcctcttaatcgcagctattcttagcgatcaagacttgcagtat
tttatcaaaattgccaaagccttgagtatgactgcattgattgaagtacatacagcagag
gagctagagcgagtattagcattggaagatgttaacctgattgggattaacaatcgcaac
ttagaagatttttcagttgatttgcaaacaacctgtcaacttttgagtagcaatagcagc
caattacaggagcgggatatcttagttgttagtgaatctgggttacatactccagaggac
attaaattagtgtctgatgctggtgctagtgctgttctcattggtgagtcattggtgaaa
caacctgatccggctagtgcgatcgctactttgtttgcctataaataa

DBGET integrated database retrieval system