KEGG   Crinalium epipsammum: Cri9333_3962Help
Entry
Cri9333_3962      CDS       T02373                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cep  Crinalium epipsammum
Brite
Enzymes [BR:cep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Cri9333_3962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4481433..4482035)
Genome map
AA seq 200 aa AA seqDB search
MIDLYTFTTPNGRKASVMLEEVELPYNIHKIDITKNEQFTPEFLAINPNSKIPAIIDQDT
GMTIFESGAILIYLAEKTGKFLPTDQKSRFEVIEWLMFQMASVGPMLGQLNHFKKFAPEQ
IPYAIERYQKETLRIYSVLDKQLSDKEFICNEYSIADMATFPWIAIYEFQGLTLDNHPNL
KRWVETVQQRPAVQRGMAVP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttacaccttcacaacacccaatgggcgcaaagcttctgttatgttggag
gaagtcgaacttccttacaacatccataagatagatattaccaagaatgaacaatttact
cctgagtttctagcaattaatcctaatagtaaaattcccgctattatcgaccaagacaca
ggaatgacaatttttgagtctggtgcgattctaatttatttagcggagaaaactggcaaa
ttcttaccgacagatcaaaaaagccgttttgaagtcatagaatggttaatgtttcagatg
gctagtgtcggacctatgttaggtcaactaaatcacttcaagaaatttgcacctgaacaa
ataccttatgctattgaacgttatcaaaaagaaacactgagaatttatagtgttttagat
aaacaattatcagataaagaatttatttgtaacgaatattctattgctgatatggcgaca
tttccctggattgctatttatgaatttcaagggttaactttagacaatcatccaaattta
aaacgttgggttgaaactgttcagcagcgtccagcagtacaacgcgggatggctgtaccg
taa

DBGET integrated database retrieval system