KEGG   Crinalium epipsammum: Cri9333_4001Help
Entry
Cri9333_4001      CDS       T02373                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cep  Crinalium epipsammum
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cri9333_4001
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cri9333_4001
Enzymes [BR:cep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cri9333_4001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4525504..4527939
Genome map
AA seq 811 aa AA seqDB search
MINPSPRPQIPSCTWNRPINLGWDKPYTVRYPSNLDDGPWHGMPLGGFGAGCLGRSSRGD
FNLWHIDGGEHTFKSLPACQFSVFEQAGNSAPQAYAMCTEPPEDGTLSTWQWYPKTGKGT
ESSGTYHALYPRSWFVYDGVFQAQLTCEQFSPIWADNYQESSYPVGVFEWTAHNPTDQPI
TLSIMLTWQNSVGWFTNAIKTPQVKVRDDGSPVYEYQPRWKDSTGNLNQWIVDHFRAGCL
LDRVRIHDEVQEGEGQWAIATITNPSVEVFYHTRWNPAGSGEEIWDNFAFDGSLRDKEDE
TPADPGEQIAAAMTIRFTVRPGRTRKIPFVLAWDFPVTEFATGVNYYRRYTDFFGRTGNN
AWSIVRTALKHDDTWKEQIQSWQELTLKNANLPDWFKMALFNELYILADGGTLWTAASET
DGIGQFGVLECLDYRWYESLDVRLYGSFALAMLWPKLDKAVLEAYARAIPTSDNTPRIIG
YNQASAIRKAANATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLGSDFVLQVYRDYLLTGA
TDIEFLSECWSAIVKTLAYLKEFDLDGDGIPENSGAPDQTFDDWRLQGVSAYCGGLWLAA
LEAAIAIGEILINHGVELEDGDFESAIATYKSWLEQSKPLYQEKLWNGQYYQLDSESGSN
VVMADQLCGQFYARLLNLPDIVPNDCVESALKTVYDSCFLKFNQKLSQHSESLTPTFIGA
ANGVLADGSPENPQATHPLEVWTGINFGLAAFMIQMGMKDEAFQLTEAVVQQIYNNGLQF
RTPEAITAAGTFRASHYLRAMAIWAIYLMIK
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcctagtccgcgtcctcaaatcccttcttgtacatggaatcgtcccatcaat
cttggttgggacaaaccttatactgttcgttaccctagcaatttagatgatggcccttgg
cacggtatgccgttgggtggttttggtgctggttgtcttggtcgttcctcgcggggcgat
ttcaacttatggcatattgatggcggagagcatactttcaaaagtctccctgcttgccaa
tttagtgtttttgaacaagctggaaattcagcaccacaagcttatgctatgtgtactgaa
ccgcctgaagatggcactttatctacatggcagtggtatcccaagacaggtaagggaaca
gaaagcagtggcacataccatgcgctatatccccgcagttggtttgtttatgatggagta
tttcaagcgcagttaacttgtgaacaattttccccaatttgggcggataactatcaagaa
agtagctatcccgtaggtgtttttgagtggacggcgcataaccctacagatcagccgatt
actctaagtattatgcttacctggcagaattctgttggttggtttactaatgcgattaaa
acaccccaggtaaaagtccgagatgatggcagtccagtgtatgaatatcaaccacgttgg
aaagatagtactggcaacttaaatcaatggattgtggatcactttcgggcagggtgtttg
ctcgatcgcgtcaggattcatgatgaagttcaggaaggtgagggacaatgggcgatcgca
actattacaaaccctagtgtcgaagtcttctaccatacccgttggaaccctgctggaagc
ggtgaggaaatttgggataacttcgcttttgatggttcattgcgggataaagaagatgaa
acacctgctgatccaggtgaacaaatagccgcagcaatgactattcgcttcactgtccgc
cctggtagaacccgcaaaattccctttgttctagcttgggattttccagttacagagttt
gccactggcgttaattattatcgtcgctatacagatttttttggtcgtactggaaacaat
gcttggtcaattgttcgtactgctcttaaacatgatgatacctggaaagagcaaattcaa
tcttggcaagagttaactttaaaaaatgctaacttgcctgactggtttaagatggcgcta
tttaatgagctatatatcttagctgatggtggcactctttggactgctgcatcggaaact
gacggcatcggtcaatttggcgttttagaatgtttagattaccgatggtatgaaagttta
gatgttcgattatatgggtcttttgctttagcaatgctttggcccaagttagataaggca
gttctagaagcttatgctagggcaattcctactagcgataatactcctcggattattgga
tacaaccaagcatccgctattcgcaaagctgctaatgctacaccccatgatttaggcgca
cctaatgagcatccttgggagaaaacaaattacactagctaccaagattgcaatttatgg
aaagatttaggttctgactttgtattgcaagtttatcgagattatctattaacgggcgct
acggatatagaatttttaagcgagtgttggtctgcaattgtcaaaactttagcttattta
aaagagtttgacttagacggcgatggtattcccgaaaattctggcgcaccagatcaaaca
tttgatgattggagattgcaaggagttagtgcttattgtggcgggttgtggttagccgcg
ttagaagctgcgatcgcaattggggagattttaattaatcatggtgtcgaattagaagat
ggtgattttgagagtgcgatcgctacctataaatcttggctagaacaatccaaacctctc
tatcaagaaaaactttggaacggtcaatattaccaacttgatagcgaaagtggttcaaat
gtggtaatggcggatcaactttgcggtcaattttatgctcggttattaaatctacccgat
atcgtgccgaatgattgcgttgaatctgcgttaaaaactgtctacgattcctgcttctta
aaattcaatcaaaagctatcacaacatagtgaaagtttaaccccaactttcattggtgca
gcaaatggtgttttagctgatggttccccagaaaatcctcaagctacccatcctttagaa
gtttggactgggattaactttgggttagcagcctttatgattcagatgggcatgaaagat
gaagccttccagctaacagaagcagttgtgcagcaaatctacaataacgggttacaattt
cgcacaccagaagccatcactgctgctggaacatttcgcgcttctcactacctccgtgca
atggcaatttgggcaatttacttgatgattaagtaa

DBGET integrated database retrieval system