KEGG   Crinalium epipsammum: Cri9333_4145Help
Entry
Cri9333_4145      CDS       T02373                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cep  Crinalium epipsammum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cri9333_4145
Enzymes [BR:cep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cri9333_4145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4679502..4681007
Genome map
AA seq 501 aa AA seqDB search
MPFPRSSGILLHPTCFPSRFGVGDLGIEAYQFIDFLRDTAQQYWQVLPLGPTGYGNSPYM
SYSAIAGNHLLISPEKLQDQGLLTDEDLANIPEFPVDRVDFGAVIETKIPLLQKACENFK
HKATPVQQKEFEGFCQSTAHWLDDYALFMALGDAHQGAGWHTWEPEIAKRKPEALEQWGL
HLSDEIFSQKFLQFEFFRQWTELKSYAKLAGVQIIGDIPIYVAHNSAEVWSHPEIFCIDE
ETGQASLMAGVPPDYFSATGQLWGNPVYNWEQLQQDNFKWWVQRFKSLLDYVDLIRIDHF
RGFESYWAVKQGETTALNGEWIKAPGEAFFKALNEQLGVLPILAEDLGVITPEVEELRDK
FEFPGMKILHFAFGSDEDNIYLPFHYPRNCLVYTGTHDNDTTVGWFNQLSDQERESVLSY
LGCTSADGIHWDLIRLALSSVANQALIPLQDVLGLDSNARMNLPSTGDGNWEWRYRADAL
TDEVRSRLKNMTVNFGRAPKK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcccagatctagtggcattttgctacatcctacttgttttcctagccgcttc
ggtgttggcgatttaggaatagaagcttaccaatttattgattttttgagagatactgcc
caacagtattggcaggtattacctttaggtcctactggctatggcaattctccttatatg
tcatattcagctatcgctggaaatcacctgctaattagtccagaaaagcttcaagaccaa
ggacttttaacagatgaagatttagccaatatccctgaatttcctgtagatagggtagat
tttggggcagtgattgaaaccaaaatacccttgctccaaaaagcttgtgagaactttaag
cataaagcaacgcccgtacagcagaaagaatttgagggtttttgtcaaagtaccgctcac
tggctagatgattatgccttatttatggcactgggagatgctcatcaaggtgctggctgg
catacttgggaacccgaaattgctaaacgtaaaccagaagccttagaacagtggggactc
catctgagtgatgaaattttttcccaaaaatttttacagtttgaatttttccgtcaatgg
acagaattaaaaagctacgcaaaactagctggagtgcaaattattggggatatcccaatt
tatgtagctcataatagtgctgaagtttggtcacatccagaaattttttgcattgatgaa
gaaacgggacaagcatccctaatggctggagttccgccagactatttcagtgctacaggt
caactatggggcaaccctgtttataactgggaacaattgcagcaggataattttaagtgg
tgggtgcaacgctttaagtctttgctagattatgtagacttaattcggattgaccacttc
cgaggatttgaatcttattgggcagttaaacaaggggaaacaaccgctcttaatggtgag
tggatcaaagcacctggagaagctttttttaaggctctcaacgagcagttaggcgtacta
ccaattctagcggaagatttgggggttattacccccgaagtagaagaattacgggataaa
tttgagtttccagggatgaaaatattacattttgcctttggatcagatgaagataatatt
tatttgccgtttcactatccccgtaactgtttggtttacactggcactcacgataatgac
acgacagtaggttggtttaatcaactttccgatcaagaacgcgagtcggtgttaagttat
ttaggttgtacaagtgctgatggtatccactgggatctgattcgtttggcactaagttct
gtagctaaccaggcacttattcctctccaagacgttttgggattagatagtaacgcgagg
atgaatttgcctagtacaggtgatggaaattgggaatggcgctatcgggcagatgcttta
actgatgaagtgcgatcgcgcttaaaaaatatgacggtaaattttggtcgcgcccctaaa
aagtaa

DBGET integrated database retrieval system