KEGG   Crinalium epipsammum: Cri9333_4244Help
Entry
Cri9333_4244      CDS       T02373                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cep  Crinalium epipsammum
Pathway
cep00010  Glycolysis / Gluconeogenesis
cep00020  Citrate cycle (TCA cycle)
cep00620  Pyruvate metabolism
cep01100  Metabolic pathways
cep01110  Biosynthesis of secondary metabolites
cep01120  Microbial metabolism in diverse environments
cep01130  Biosynthesis of antibiotics
cep01200  Carbon metabolism
Module
cep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cri9333_4244
   00020 Citrate cycle (TCA cycle)
    Cri9333_4244
   00620 Pyruvate metabolism
    Cri9333_4244
Enzymes [BR:cep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cri9333_4244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase GCV_H MadL Ribosomal_L18p Redoxin GAGA_bind
Motif
Other DBs
NCBI-ProteinID: AFZ15033
UniProt: K9W3X0
Position
complement(4788155..4789471)
Genome map
AA seq 438 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWLKSPGDKVEKGETVVVVESDKADMDVESFYEGYIATIV
VAAGEAAPVGAAIALVAETEAEIETAKQQASQNNSSASAATPQAEAQPAVAVVEAAPAAT
QANGNGSRQNGRTVVSPRAKKLAKELKVDLNTLQGSGPHGRIVAEDVQAAANPGKQTAGT
TATPGMVPVTPPVAPAPVTPTAKPAPAPVAPAATGGQVVALNTLQNAVVRNMVASLQVPT
YRVGYTITTDNLDKLYKQVKSKGVTMTALLAKAVAVTLQKHPLVNASYTEQGIQYHGAIN
IAVAVAMDDGGLITPVLQNADQMDIYSLSRAWKDLVDRSRSKQLQPQEYNSGTFTLSNLG
MFGVDRFDAILPPGQGSILAIGAARPQVVATEDGLMGVRRQMQVNITCDHRIIYGAHAAA
FLKDLAKLIETNAQSLTM
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatccatgaagttttcatgcccgcgctgagttccaccatgactgaaggtaaaattgtc
tcctggctcaagtccccaggcgacaaagtggaaaaaggcgaaaccgttgtggtggtcgag
tcggacaaggcggatatggatgttgagtccttttatgagggctatatagctacaatcgtt
gtagctgctggtgaagctgctcctgtgggtgctgcgatcgcactcgttgcagaaacggaa
gcagaaatagaaaccgccaagcaacaagcctctcaaaacaattcttccgcgagtgctgct
accccacaagccgaagcacaaccagcagtagcggtagttgaggctgccccagcagctact
caagcaaatggcaatggtagtcgccaaaatggacgcaccgttgtttctcctcgcgccaag
aaattagctaaagaactcaaagttgatctcaacaccttgcaaggtagtggtcctcacggg
cgcattgttgcagaagatgtccaagctgctgctaacccaggtaaacaaaccgcaggtaca
actgcaacacctggaatggttcctgtcaccccacctgtagcacctgcaccagttacaccc
acagctaaacccgcaccagcaccagtagcacctgcggctactggtggtcaagtagtagca
ttaaacacactacaaaacgccgtagtgcggaacatggttgccagcttgcaagttcctact
taccgcgttggttacactatcaccacagataatctagataagctttacaagcaagttaaa
tctaagggtgtcaccatgacagcactgctggctaaagctgtagcagtgactttacaaaaa
catcccttagtaaatgccagctatacagagcaaggtatccagtatcacggtgctattaat
attgccgtagcagtagcaatggatgatggtgggctaattacccctgtactgcaaaatgcg
gatcaaatggatatctactccttatctcgcgcttggaaagatttagtagatcgttcccgc
agcaagcagttacagccacaagagtataattctggtacttttacattatccaatctagga
atgtttggcgttgaccgttttgatgccattctcccaccaggacaaggttccattctggct
attggtgcggcacgtcctcaagtcgtagcaacagaagatgggttgatgggagtacgccga
caaatgcaggtaaatattacttgcgatcaccgcattatttatggcgctcatgcggctgca
ttcttaaaagatttggcgaagttgattgaaacaaatgctcaatctttgacgatgtaa

DBGET integrated database retrieval system