KEGG   Chlamydia trachomatis E/SW3: ESW3_0331Help
Entry
ESW3_0331         CDS       T02164                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ces00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ESW3_0331 (recD)
Enzymes [BR:ces01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ESW3_0331 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37092..39332)
Genome map
AA seq 746 aa AA seqDB search
MGCEEKLSGILELILPEDPLSDQTGYAFLRVPYKNSLVTVCGHLPLSLFKIGSSVDLTGH
WSVDASGALVFRFTSAATYSPDSGIIAYLNAQIKGVGPKLAQKIVSTFGEDTLTVLDSCP
SKLVEVDGISPARCEDFSKQLQEQRDLRHALLFLQRHGIAIHYGLRLYKKYQNQTIEKVC
QDPFLLAKEMYGIGFKTADLIATCLGVPLNSPNRIVAGIQYSLDELQEEGHTCYPLNDFI
VLVEKLLNEEAPEEIIRKEEIRTQIHFLSRQKTVYVKELEQDTYIWSRQLFLAEQQIAID
IRRLLFSSKRIRSINTQEAILEVENLLDLKLEEKQKEALHASSSQKIHIISGGPGTGKST
ITRAILSIFEKISSPKKIILAAPTGKAAKRMTEITGKRTQTIHSLLQYDFKTLSFRKNHE
DPIDCDLVIVDESGMIDTILLQRFLAALPDHAILILIGDVHQLPSVGPGNVLKDLILSHH
IEVTYLTKIFRQLQNSNIITNAHKVNQGEFPVLNSSSGKKDFLFFQKEDPEEAIKHIIHL
VSDFVPKKFGIFTKDIQVLAPMRKGVLGILNLNRELKAALNPNKLFIQGKFHSFSTGDRV
MQTRNNYNKEVFNGDIGYVTSIDLSTKSLIVCVDGRYISYSQAELNDLIPAYATSIHKYQ
GSETSCIILPIHTSHYVMLYRNLLYTAITRGKKLVILVGTKKAVAIAVRNDKVQHRCTGL
QQAMHSLLNKPTPLFSPYTICRPSLG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtgaagagaaactttccggtattttggagctgatcctgccagaagatcccctg
tccgatcaaacagggtacgccttcctacgagtcccttacaaaaattcactagtaactgtt
tgtggccatctcccgctctctttgttcaaaatcggctcctctgtagacttaacaggtcat
tggagtgtagatgctagcggagcattagtgtttcgctttacctccgctgcaacctatagt
cctgattccggaatcatagcttacctgaatgctcaaatcaaaggcgtaggccccaaactt
gctcaaaaaattgtctcaaccttcggggaagacacgttaacagtactcgattcctgtcct
tctaaattggtagaagtagatgggatttctcctgcccgctgcgaagatttttctaagcaa
ctccaagagcaaagagacctacgtcatgctttgttatttctacaacgacatggaatagcc
attcattatggtttacggctgtataaaaaataccaaaatcaaacgatcgagaaggtctgt
caagatccctttctgcttgcaaaggaaatgtacggtataggttttaaaaccgctgatctt
attgctacgtgcttaggagtccctctaaattcccctaatcgtatcgttgctggaattcaa
tactctctagatgaacttcaagaagaagggcatacctgctaccctcttaatgattttatt
gttctcgtagaaaaactgttgaatgaagaagctccagaggagatcatacggaaagaggaa
atccgtacccaaatccatttcttgtcacgccagaagacagtctatgtcaaggaactcgaa
caagatacctatatttggtcgcgccaactttttctagctgaacaacaaattgcgattgat
attcgaagactcttgttttcttctaaacgaatacgatctatcaatacccaggaagcgatt
ctggaggttgaaaatcttctggatttgaaattggaagaaaaacaaaaagaagctcttcat
gccagctcttcacaaaagattcatattatatctgggggaccaggaacaggaaaaagtaca
attacacgtgctatcctttctatctttgaaaagatctcctcccctaagaaaataatccta
gcagcacctacaggaaaagctgcgaaacgtatgacagaaatcacagggaaacgtactcaa
actatccactctcttctccagtatgatttcaaaaccttgtcatttcgaaagaatcacgaa
gatcctattgattgtgatcttgttattgtcgatgaatctggaatgatcgacaccattctc
ttacaacgctttctagctgcactgcctgatcatgctatcctaattctaattggagatgtg
caccagcttcccagcgtaggccctggtaatgtccttaaagatcttattctttcccatcac
atcgaggtaacctacctaacgaaaatcttccgtcagttgcaaaattcgaatatcattaca
aatgcccataaagtaaaccaaggagaattcccagttctcaacagctcttcagggaaaaaa
gactttttattttttcaaaaagaagaccctgaagaagcgattaaacacatcattcatctc
gtttcggattttgttcctaaaaaatttggtatctttaccaaagatattcaagtccttgct
cccatgagaaaaggggtattaggaatactcaatctaaatagagagttaaaagcagcactt
aatcctaataaactgtttatccaagggaaatttcactccttctctacgggagatcgcgtt
atgcaaacgcgtaataactataataaagaggtattcaacggagatatcggttatgtgacc
tctattgacctatctacaaagagtttgatcgtttgcgtggatggccgctatattagttat
tcgcaagcagaactcaatgacctgataccagcttatgctacttccatacacaaataccaa
ggaagtgagacctcctgtattattcttcctattcacacctctcattacgtgatgctgtat
agaaacttactctatacagcaattacacgagggaaaaaactagtcattttagtaggaaca
aagaaagcagttgctattgctgttcgtaatgacaaggttcaacaccgatgtaccgggctg
caacaagctatgcactcccttcttaacaaaccaactcctcttttctctccttacactatt
tgtagaccgtctctaggataa

DBGET integrated database retrieval system