KEGG   Chlamydia trachomatis E/SW3: ESW3_2421Help
Entry
ESW3_2421         CDS       T02164                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ces00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ESW3_2421 (recR)
DNA repair and recombination proteins [BR:ces03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ESW3_2421 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
268149..268751
Genome map
AA seq 200 aa AA seqDB search
MLKYPDYISKLISFLKKLPGIGFKSAEKIAFELLEWDPSQIEAMALALQEFSTSHATCSN
CFCLKISQTSPCNFCSESRDSSSLCIVATPKDVFALEKSKIFKGHYFVLGNLLSPITGKH
LSLEKLAILKQRIEACSPKEMIIALDATLEGDATALFLKQEFSYLPIKISRLALGMPVGL
SFDFVDANTLARAFSGRNCF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatatcctgattacatttcgaaactcatttcatttttaaaaaagcttccagga
attggctttaaatcagcagaaaaaatagcttttgaattattagaatgggatccatctcaa
attgaggctatggccctagcattacaagagttctctacttcgcatgcaacttgctcaaac
tgtttttgtttaaaaatctctcaaacttccccttgtaacttttgcagtgaatctcgagat
tcttcttccttatgtattgttgcaactcctaaggatgttttcgctctggagaaatctaag
atcttcaaaggacactatttcgttttaggaaacttactttctcccatcactggaaagcat
ttgtctttggaaaaattagctattcttaagcagcgaattgaagcttgttcccctaaagaa
atgatcatagctcttgacgcaactttggaaggagatgcaactgcattgtttttgaaacaa
gaattttcttaccttccaataaaaatctctagattagctcttgggatgcctgtcggtctc
tcctttgattttgttgatgctaatactttagctcgagctttttcaggaagaaattgcttt
taa

DBGET integrated database retrieval system