KEGG   Chlamydia trachomatis E/SW3: ESW3_2491Help
Entry
ESW3_2491         CDS       T02164                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ces00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESW3_2491 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESW3_2491 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ESW3_2491 (pdhC)
   00620 Pyruvate metabolism
    ESW3_2491 (pdhC)
Enzymes [BR:ces01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ESW3_2491 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276607..277896
Genome map
AA seq 429 aa AA seqDB search
MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL
VKEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEETVVTDAATEASPKDSAQTDSQYTSGP
SITMMGFRPEPPLATPLTIKHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIVKKDL
EKAPPLRIAGFGYPEAPNVNPGSYIEEPLSPVREVISKRLQAAKTFIPHFYVRQRIYASP
LLALLKELQEQNIKLSINDCIVRACALALKEFPEINSGFNSVDNKIIRFSTIDISIAVAI
PDGVITPIVRCADRKNIGMISAEIKGLATKAKQQSLAEEEYKGGSFCVSNLGMTGISDFT
AILNPPQAAILAVGSVEEQPVVLNGELAVGSTCMLTLSVDHRVIDGYPAAMFMKRLQRLL
EAPSVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggtttctttgttaaaaatgcctaagctctcccctacaatggaaatagggattcttgtt
aaatggcacaaaaaagctggggatgaaattcatttcggggatgtattactagaaatctct
actgataaagctgttttagaacatacagcttctgaagatggttggttattagaaattctt
gttaaagaaggaaccaaaactcctattggcactcctatcgctgtattttcaacagaacaa
aatgctcaatatgatttaaaacagctcctacctttggaagaaactgttgttacagatgca
gctacagaagcatcgccaaaagactctgctcaaacagattctcaatacacaagtggccct
tccataactatgatgggattccgtccggaaccacctttagctactcctctaactattaaa
cattccaacgatccagtattagcttctcctttagcaaaaaaattggccaaagagcaaaat
ctagacctctctggagtaactggtagtggacctggaggacggatcgtaaagaaagatttg
gaaaaagctcctcctttaagaattgctgggtttggttaccctgaagctccaaatgttaat
ccgggatcttatatagaagaacctctttcccctgttcgagaagtcatatctaaacgtctg
caagctgctaaaacctttattcctcacttttatgtaaggcagcgcatttacgcttccccc
cttcttgcattattaaaagaacttcaagaacaaaatattaagctctctatcaatgattgt
attgtacgagcctgtgctttagctctgaaagaattcccagaaattaattctggattcaat
agtgtcgacaataagattattcggttttctacgattgatatctctattgctgtagctatt
cctgatggagttatcactcctattgtccgctgtgctgatagaaaaaatattggtatgatc
tctgcagaaatcaaaggacttgcaactaaagccaaacagcagtctcttgcagaagaagaa
tacaaaggaggttctttctgtgtatctaatcttggtatgacagggatctctgatttcact
gctattttgaatcctccacaagctgctattctagctgtaggaagcgtagaggaacaacct
gtagtcttaaatggagagctagctgtaggctcgacctgtatgttgacattgtcggtagac
cacagagtgattgatggatatcctgcagccatgttcatgaaacgactgcagagactcctc
gaagctccttctgttttacttctcaattaa

DBGET integrated database retrieval system