KEGG   Chlamydia trachomatis E/SW3: ESW3_3311Help
Entry
ESW3_3311         CDS       T02164                                 

Gene name
tpiS
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
ces00010  Glycolysis / Gluconeogenesis
ces00051  Fructose and mannose metabolism
ces01100  Metabolic pathways
ces01110  Biosynthesis of secondary metabolites
ces01120  Microbial metabolism in diverse environments
ces01130  Biosynthesis of antibiotics
ces01200  Carbon metabolism
ces01230  Biosynthesis of amino acids
Module
ces_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ces00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESW3_3311 (tpiS)
   00051 Fructose and mannose metabolism
    ESW3_3311 (tpiS)
   00562 Inositol phosphate metabolism
    ESW3_3311 (tpiS)
Enzymes [BR:ces01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ESW3_3311 (tpiS)
Exosome [BR:ces04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ESW3_3311 (tpiS)
  Exosomal proteins of bladder cancer cells
   ESW3_3311 (tpiS)
  Exosomal proteins of melanoma cells
   ESW3_3311 (tpiS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCE12604
Position
370490..371314
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFISSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTIGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLALCPDVNGLLVGGASLSSENFLSIIQQIDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaagacgcttaccgaa
gctcagacctttttaaaaagtttcatctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaagctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaagctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactttagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactataggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcacttgccctctgccctgatgttaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaaatcgatatcccataa

DBGET integrated database retrieval system