KEGG   Chlamydia trachomatis E/SW3: ESW3_3311Help
Entry
ESW3_3311         CDS       T02164                                 

Gene name
tpiS
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ces00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESW3_3311 (tpiS)
   01230 Biosynthesis of amino acids
    ESW3_3311 (tpiS)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESW3_3311 (tpiS)
   00051 Fructose and mannose metabolism
    ESW3_3311 (tpiS)
   00562 Inositol phosphate metabolism
    ESW3_3311 (tpiS)
Enzymes [BR:ces01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ESW3_3311 (tpiS)
Exosome [BR:ces04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ESW3_3311 (tpiS)
  Exosomal proteins of bladder cancer cells
   ESW3_3311 (tpiS)
  Exosomal proteins of melanoma cells
   ESW3_3311 (tpiS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
370490..371314
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFISSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTIGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLALCPDVNGLLVGGASLSSENFLSIIQQIDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaagacgcttaccgaa
gctcagacctttttaaaaagtttcatctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaagctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaagctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactttagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactataggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcacttgccctctgccctgatgttaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaaatcgatatcccataa

DBGET integrated database retrieval system