KEGG   Chlamydia trachomatis E/SW3: ESW3_4641Help
Entry
ESW3_4641         CDS       T02164                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ces00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ESW3_4641 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ESW3_4641 (murA)
Enzymes [BR:ces01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ESW3_4641 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(530603..531937)
Genome map
AA seq 444 aa AA seqDB search
MPGIKVFGETVLRGSVRVSGAKNATTKLLVASLLSDQRTILKNVPNIEDVRQTVDLCRVL
GAIVEWDQQAQVIEIHTPRILLSKVPPQFSCVNRIPILLLGALLRRCPYGIFVPILGGDA
IGPRTLHFHLEGLKKLGAEIVISDEGYWASAPNGLVGAHITLPYPSVGATENLILASVGA
QGRTIIKNAALEVEIIDLIVFLQKAGMEITTDNDKTIEIFGCQDFYSVEHSIIPDKIEAA
SFGMAAVVSQGRIFVEQARHEHMIPFLKVLRSIGGGFSVHENGIEFFYDKPLKGGVLLET
DVHPGFITDWQQPFAVLLSQSEGCSVIHETVHENRLGYLKGLVKMGAHCDLFHECLSAKS
CRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAALIAEGGASWIENTEMLDRGY
TDWRGKLERLGAKVLARDSVSVYV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtatcaaggtttttggagaaacggtcttaagaggatctgtgcgcgtgtcagga
gctaaaaatgctacaactaaattacttgtagcctccttactttcggatcagcgaacgatt
ttaaagaatgtccctaatattgaagatgttcggcaaacggtagatctttgtcgggtttta
ggggcgattgtagagtgggatcagcaagcgcaagtgattgaaattcacactccgcgcatt
ttattgtccaaggttcctccgcaattttcttgtgttaatcggattcctattttgctgtta
ggagcgttgttacgtcgttgtccttatgggatttttgttcctattttgggaggggatgct
ataggacctcgtacgctacatttccatttagaaggattgaagaagcttggagcagagata
gtaattagtgatgaaggctattgggcttcagctccaaatggtcttgttggagcacacatc
acgttaccctacccttctgtgggagccacagaaaacctcatccttgcttctgtaggggct
caaggacgaacgattattaagaatgctgctcttgaagtggaaatcattgatttgattgtc
tttttacagaaagcaggcatggagattacaacagataatgataagaccatcgaaattttt
ggatgtcaggatttctattctgttgagcactccattattccagataaaatcgaggctgct
tctttcggtatggctgcggtagtttctcagggaaggatcttcgtagaacaagcgcgccat
gagcatatgatcccttttttaaaggtattaagatcgataggagggggattctctgtacat
gagaatgggatcgaatttttctacgataagcctttgaaagggggagttcttctagaaacg
gatgtgcatccagggtttattacagattggcaacaaccttttgccgtattgctctctcag
tcagaaggttgttcggtgatccatgagacagtgcatgagaatcgtcttgggtatttgaaa
ggtttggtaaaaatgggagcgcattgtgatttatttcacgagtgtttgagtgctaagtcg
tgtcgctattctacagggaatcatcctcatagcgcagtcattcatggtccgactcctttg
caggcaacagacttagtgattcctgatttgcgcgcaggatttgcttatgtcatggccgca
ctcattgcagaaggcggagcctcatggattgagaataccgagatgctggatcgagggtac
actgattggcgagggaaattagaaagattaggagctaaggttttagcgcgagactcagta
tctgtgtatgtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system