KEGG   Chlamydia trachomatis E/SW3: ESW3_4641Help
Entry
ESW3_4641         CDS       T02164                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ces00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ces00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(530603..531937)
Genome map
AA seq 444 aa AA seqDB search
MPGIKVFGETVLRGSVRVSGAKNATTKLLVASLLSDQRTILKNVPNIEDVRQTVDLCRVL
GAIVEWDQQAQVIEIHTPRILLSKVPPQFSCVNRIPILLLGALLRRCPYGIFVPILGGDA
IGPRTLHFHLEGLKKLGAEIVISDEGYWASAPNGLVGAHITLPYPSVGATENLILASVGA
QGRTIIKNAALEVEIIDLIVFLQKAGMEITTDNDKTIEIFGCQDFYSVEHSIIPDKIEAA
SFGMAAVVSQGRIFVEQARHEHMIPFLKVLRSIGGGFSVHENGIEFFYDKPLKGGVLLET
DVHPGFITDWQQPFAVLLSQSEGCSVIHETVHENRLGYLKGLVKMGAHCDLFHECLSAKS
CRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAALIAEGGASWIENTEMLDRGY
TDWRGKLERLGAKVLARDSVSVYV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtatcaaggtttttggagaaacggtcttaagaggatctgtgcgcgtgtcagga
gctaaaaatgctacaactaaattacttgtagcctccttactttcggatcagcgaacgatt
ttaaagaatgtccctaatattgaagatgttcggcaaacggtagatctttgtcgggtttta
ggggcgattgtagagtgggatcagcaagcgcaagtgattgaaattcacactccgcgcatt
ttattgtccaaggttcctccgcaattttcttgtgttaatcggattcctattttgctgtta
ggagcgttgttacgtcgttgtccttatgggatttttgttcctattttgggaggggatgct
ataggacctcgtacgctacatttccatttagaaggattgaagaagcttggagcagagata
gtaattagtgatgaaggctattgggcttcagctccaaatggtcttgttggagcacacatc
acgttaccctacccttctgtgggagccacagaaaacctcatccttgcttctgtaggggct
caaggacgaacgattattaagaatgctgctcttgaagtggaaatcattgatttgattgtc
tttttacagaaagcaggcatggagattacaacagataatgataagaccatcgaaattttt
ggatgtcaggatttctattctgttgagcactccattattccagataaaatcgaggctgct
tctttcggtatggctgcggtagtttctcagggaaggatcttcgtagaacaagcgcgccat
gagcatatgatcccttttttaaaggtattaagatcgataggagggggattctctgtacat
gagaatgggatcgaatttttctacgataagcctttgaaagggggagttcttctagaaacg
gatgtgcatccagggtttattacagattggcaacaaccttttgccgtattgctctctcag
tcagaaggttgttcggtgatccatgagacagtgcatgagaatcgtcttgggtatttgaaa
ggtttggtaaaaatgggagcgcattgtgatttatttcacgagtgtttgagtgctaagtcg
tgtcgctattctacagggaatcatcctcatagcgcagtcattcatggtccgactcctttg
caggcaacagacttagtgattcctgatttgcgcgcaggatttgcttatgtcatggccgca
ctcattgcagaaggcggagcctcatggattgagaataccgagatgctggatcgagggtac
actgattggcgagggaaattagaaagattaggagctaaggttttagcgcgagactcagta
tctgtgtatgtttaa

DBGET integrated database retrieval system