KEGG   Chlamydia trachomatis E/SW3: ESW3_6241Help
Entry
ESW3_6241         CDS       T02164                                 

Gene name
folP
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ces00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ESW3_6241 (folP)
Enzymes [BR:ces01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ESW3_6241 (folP)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ESW3_6241 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(693217..694569)
Genome map
AA seq 450 aa AA seqDB search
MTSWNFVCLSLGSNLGNRHEHIRRAYASLKKAGIRNLKSSVILETKALLLEGAPKEWDLP
YFNSVVIGETQLSPDELIEEIKMIESCFGQDASLKWGPRPIDIDVLFYGDEAFSYHSDKC
TIPHPKVLERPFLLSMMASLCPYRRFRLEGSSCNGKTFAELAAIYPLTEEDALGSFGSAT
QIMGIVNITDNSISDTGLFLEARRAAAHAERLFAEGASIIDLGAQATNPRVKDLGSVEQE
WERLEPVLRLLAERWGAAQQCPDVSIDTFRPEIIRRAVEVFPIRWINDVSGGSLEMAHLA
KEFGLRLLINHSCSLPPRPDCVLSYEESPIEQMLRWGESQLEQFAQVGLDTSWQVVFDPG
IGFGKTPVQSMLLMDGVKQFKRVLECPVLIGHSRKSCLSMLGRFNSNDRDWETIGCSVSL
HDRGVDYLRVHQVEGNRRALAAAAWAGMFV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactagttggaattttgtttgtttaagtttgggttccaatttaggtaaccggcatgag
catataagacgcgcttatgcaagtttaaagaaggctgggatccgaaatttaaaaagttct
gtaattttagagacgaaggctttgttgttagaaggggctccgaaagaatgggatcttcct
tattttaactctgtggttattggggaaacgcagctatctccagacgagttgattgaagaa
atcaagatgatagaaagttgttttggacaagatgcttctttgaaatgggggcctcgaccg
attgatattgatgtgcttttctatggagacgaagctttttcttatcatagtgacaaatgt
acaatcccacatcctaaggtattagaaagaccttttcttctttctatgatggcttcttta
tgtccgtatcgtcgtttccgtttggaaggatcttcttgtaatgggaaaacgtttgcagag
cttgctgctatttatccattgacggaggaggatgcgttaggcagtttcggttctgctacc
caaattatgggtattgttaatattacggataactcgatctccgatacaggattgtttctg
gaggcgagaagagccgcagcccatgctgagagactctttgcagaaggagcttctattatt
gatttaggggcgcaagcaaccaatcctcgtgtaaaagatttaggaagcgtagaacaagag
tgggagcgtctagaacctgttttgcgtttattagcggagcggtggggggctgctcaacaa
tgccctgatgtatctatcgatacatttcgtccagagattattcgacgagctgttgaagta
tttccgattcgttggatcaatgatgtttctggaggctctttggaaatggctcatttggcg
aaggagtttgggctacggctattaataaatcattcgtgttcgctgcctccaagaccagat
tgtgtactttcttatgaagaatctcctattgagcaaatgttgcgttggggagagtcccag
ttagaacaatttgctcaagtaggtttagatacaagttggcaagttgttttcgatccagga
ataggatttgggaagactcccgttcagtcgatgttattgatggatggagtaaagcagttt
aaacgtgttttagagtgtcctgtattaataggccattctagaaaatcgtgtttgagtatg
ttgggccgatttaatagtaacgatcgtgattgggaaacgatcggctgttctgtatctctt
catgatcgaggagttgattatctacgcgtgcatcaggttgaaggtaacagacgtgcctta
gccgctgctgcttgggctggtatgtttgtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system