KEGG   Caldisericum exile: CSE_00260Help
Entry
CSE_00260         CDS       T01804                                 

Gene name
aor
Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cex  Caldisericum exile
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_00260 (aor)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CSE_00260 (aor)
Enzymes [BR:cex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CSE_00260 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25724..27532
Genome map
AA seq 602 aa AA seqDB search
MLGGYMGKIARVNLSTGVVEIEPINEELAKKFIGARGYAAKIIFDEVPRHADPLGPENKL
IFATGPLTLTTAPTGGRYDVVTKSPLNNVIAASNSGGFFGPELKKAGFDMLIVEGKSNKP
VYLWVHDGNVEIRDASHLWGKDTYETTDMLLEEVGDKTAKVACIGPAGEKLSMQACVIND
KARAAGRTGVGAVMGSKMLKAVVAKGNLRAPIADNEAFKEALRVAMDKIKTNGVTSQGLP
TYGTMVLNHIIDEHGLYPTNNFQKGTFEYVDEVSGEKLKDTYLIRNKACFACPIGCGRVV
RIPEIEEEVEGPEYETSWAFSADCGVKDLKAVITANHLCNKLGLDTIATGATIAALMELY
EKGYVPKEHIGDLPEPKFGNASAIVEYTKAIGLRIGIGDKLAKGSYEFASEYGHPELSMS
VRKQELPAYDPRGAQGHALEYATSNRGGCHVRGYMISPEILGVPEKLDPFATDGKAQWVK
TFQDLTAVIDSEGLCLFTSFALGLSDYTAMLKAATGFDYTEDEVMKAGERIWNLERLWNI
DLGVGPEEDKLPERFIKEPLPDGASKGQVVRLDLTLPDYYKVRGWDEKGYPKEEKLRELG
LK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtggctacatggggaagattgcaagagtaaacctctcaacaggagttgtagag
atcgagcctattaacgaggaacttgcaaaaaaatttatcggtgcaaggggttatgctgca
aaaatcatctttgatgaagttccgaggcatgctgatccacttggtcctgaaaataaactg
atttttgcaacaggtccacttacacttaccacagcgccaacgggtgggcgttatgatgtt
gttacaaaatcaccattgaataatgttattgctgcatcaaactctggcggattttttggt
cctgagttaaagaaggctggctttgatatgcttattgtggaaggaaagtctaacaagcct
gtgtatctttgggttcatgatggaaatgtggaaattagagatgcatcacacctctggggt
aaggatacctatgagacaaccgatatgcttcttgaagaggttggtgataaaacggcaaag
gttgcttgcattgggcctgcaggcgaaaaactttcaatgcaagcatgtgttattaacgat
aaggcaagggctgcaggtaggactggcgttggagcagtaatgggttcaaaaatgttaaag
gcagttgttgcaaaaggaaatcttagggctccaattgcagataatgaagcgttcaaagaa
gcgttgcgtgttgcaatggacaagataaagacaaatggtgtaacttcacaggggcttccg
acatatggaacaatggttctaaaccacattattgatgaacatggattgtacccaacgaac
aacttccaaaaaggcacatttgaatatgttgacgaggtctcaggagagaaattgaaggac
acatatcttataagaaacaaggcttgttttgcatgtccaataggttgtgggcgtgttgta
agaattcccgaaatcgaagaagaagttgaagggcctgaatatgaaacaagttgggcattc
agcgcagattgtggtgtgaaagatctcaaagcggttattactgcaaaccacctttgcaat
aaacttggccttgatacaattgctacaggtgcaacaattgctgccctaatggaactttat
gaaaaaggatatgtgcctaaggaacatattggtgatctcccagaaccaaagtttggtaat
gcaagtgctattgtcgaatacacaaaggcaattggattaagaataggcattggtgataaa
cttgcaaaaggctcttatgagtttgcatcagaatatgggcatccagaactttcaatgagt
gtaaggaagcaagaacttccagcatatgatccaagaggcgctcaaggacatgctcttgaa
tatgctacctccaaccgtggtggttgccatgtgagaggttatatgatttcgccagaaatc
cttggcgtacccgagaaacttgacccatttgcaacagatggtaaagcgcaatgggttaag
acgttccaagatcttacagcagtaattgactctgagggattatgcctgtttacttcgttt
gctttgggattatctgactatacagcaatgcttaaagcggcaacaggatttgactataca
gaggatgaagttatgaaagcaggtgaaagaatatggaaccttgaaagactgtggaatatc
gatctcggtgttggaccagaagaagataaacttcctgaaagattcattaaagagccactt
ccagatggtgcttcaaaaggacaagttgttagacttgacctaacattgcccgattattac
aaagttcgtggttgggacgaaaagggatacccaaaagaagagaaactaagagaacttgga
ctaaaatag

DBGET integrated database retrieval system