KEGG   Caldisericum exile: CSE_00950Help
Entry
CSE_00950         CDS       T01804                                 

Definition
NAD-dependent epimerase/dehydratase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cex  Caldisericum exile
Brite
Enzymes [BR:cex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     CSE_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83927..84940
Genome map
AA seq 337 aa AA seqDB search
MIGVIGGTGHLGNVLIRELLKRGEHVVCIVPKGEDLTPISGLAVEVRTGDITDFESINKA
LFGVDYVYHTAGVISISKGEWEKLYKVNVLGTRNVVEACIKNNVKRLVYTSSIHAFKEPP
LDLPITEDIPLEPQFGEYARSKALATLEVLRGVERGLDAVIVAPTGIIGPYDFKVSEMGT
LILKYMNSKLFFYVDGAYDFVDVRDVAMGEILAMKKGKIGQIYILSGEKITVKEILEILR
NISGKRISHIKISYSLAKFSALFTPIISQITKEKPLFTLYSLSVLKSNCNVLKDKAIKEL
GYTSRPLETSLKDAYLWFKENYRGGTHFKKLSPNVSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgattggagtaattggaggaacagggcatcttggtaatgtcctcataagagaactgtta
aaaagaggtgagcatgttgtttgcattgtcccaaagggtgaagatcttacacccataagt
ggtcttgccgttgaagttagaacaggcgatattacagattttgaaagtattaataaagca
ctttttggtgttgattacgtatatcacacagcaggtgttatctctataagcaaaggggaa
tgggaaaagttatataaggtaaatgttttgggcacaagaaatgtggttgaagcgtgcata
aaaaacaacgtaaagaggcttgtctatacaagttcaatacatgcatttaaggagccccca
cttgatttacctataaccgaagatattccgttagagcctcaatttggcgaatatgcaaga
tctaaggctcttgcaaccttagaagtcttaagaggtgttgaaagaggtcttgatgcggtg
attgttgcaccaacagggattattggcccctatgattttaaggtttcagaaatggggaca
ctaattctcaaatatatgaacagtaaattatttttctatgttgatggtgcttatgacttt
gttgatgtaagggatgttgcaatgggtgaaattcttgcaatgaaaaaaggaaagataggt
caaatttatatcctttctggagagaaaataaccgtaaaagaaatccttgaaatacttagg
aatatctcaggaaaaagaatatcacatataaaaatttcatattctcttgcaaagttttct
gcgctctttaccccaattatttcacaaatcacaaaagaaaagcctctttttacgctttat
tctctatcagttctcaaatcaaactgtaatgtattaaaggacaaggcgattaaggaattg
ggatacacttcaaggccattagaaacatcattaaaggatgcatatttgtggtttaaagaa
aattatagaggaggaacacattttaaaaaactttcaccgaatgtatcgcagtga

DBGET integrated database retrieval system