KEGG   Caldisericum exile: CSE_01750Help
Entry
CSE_01750         CDS       T01804                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cex  Caldisericum exile
Pathway
cex00010  Glycolysis / Gluconeogenesis
cex00020  Citrate cycle (TCA cycle)
cex00620  Pyruvate metabolism
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01120  Microbial metabolism in diverse environments
cex01130  Biosynthesis of antibiotics
cex01200  Carbon metabolism
Module
cex_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_01750 (acoC)
   00020 Citrate cycle (TCA cycle)
    CSE_01750 (acoC)
   00620 Pyruvate metabolism
    CSE_01750 (acoC)
Enzymes [BR:cex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CSE_01750 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: BAL80301
UniProt: I0GHR4
Position
162293..163453
Genome map
AA seq 386 aa AA seqDB search
MFEIRMPKFGLSMEEGTITKWYKKVGDFVKKGEPLVEVESEKIINTLESPFEGILKVIKV
NEGETAKVGEIIGLIGSEDETIKEITEEKRVITSEESKVRKLTESKIGEEKSEEVILASP
AAKRLAKEYGVDLSNIKGTGPSGRIVENDVIAFVEKMKQTKPVSKKIPLDPVRKRIMDNL
VKSYKESVLVTNITKIDLTNLISFKKEFPDITLTAFFVKIVSNVLKDFPKFNAHFDGNEL
EIFDAINIGVAFDTANGLIVPVIRNVQEKSLKEIAQELQTLKAKVEENSLNVDDLTGSTF
TITNLGMMRTDMFTPVLNGKEVAILGIGRTLKEPTVAEDKVVVRDFAYFSLSYDHRVIDG
ADAARFLGKLAEYFELTDNFQKINKI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaataagaatgcccaaatttgggctttcaatggaagagggcaccattacaaaa
tggtacaagaaggttggggattttgttaaaaaaggcgaacctcttgttgaagttgaatcc
gaaaagataattaacacgcttgaatcaccttttgaaggtatccttaaagtaattaaggta
aatgaaggagaaaccgcaaaagttggagaaattattggtctaattggaagtgaagatgaa
acgataaaagaaattactgaagagaaaagagtaattacttctgaggagagtaaagtaagg
aaacttaccgaatcgaaaataggagaagagaaatcggaagaggttattcttgcttcacct
gccgctaaaagacttgcaaaagagtatggtgtagatctttcgaatattaaaggcacagga
ccatcgggtcgcattgttgagaacgatgtaattgcttttgttgagaaaatgaaacaaact
aagccagtctctaaaaaaattcctcttgaccctgtaagaaaaagaatcatggataacctt
gttaagtcctacaaagagtcggttcttgtaacaaacataactaaaatagatttaacgaat
ttaatttcttttaaaaaggagtttcctgatattacacttactgcgtttttcgttaagata
gtttctaatgttttaaaggattttccaaaatttaatgcacattttgatggaaatgaactt
gaaatttttgatgcaattaacattggtgttgcatttgacacggctaacggtcttattgtc
ccagttataaggaatgttcaggaaaaatctcttaaagaaattgcgcaagaacttcaaaca
ctaaaagcaaaagtagaagaaaactctttgaacgtagatgatttaactggttcaacgttt
acaattacaaatcttggtatgatgagaacagatatgtttacaccagttttaaatggtaaa
gaagttgccattcttggcatagggaggactttaaaagagcctaccgttgccgaggataaa
gttgttgtaagagactttgcttactttagtttgtcttacgaccatcgtgtaattgacggt
gcagatgctgcaagatttttaggaaagcttgcagaatattttgagttaacagacaatttt
caaaaaataaataaaatttaa

DBGET integrated database retrieval system