KEGG   Caldisericum exile: CSE_01750Help
Entry
CSE_01750         CDS       T01804                                 

Gene name
acoC
Definition
acetoin dehydrogenase E2 component (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_01750 (acoC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_01750 (acoC)
   00020 Citrate cycle (TCA cycle)
    CSE_01750 (acoC)
   00620 Pyruvate metabolism
    CSE_01750 (acoC)
Enzymes [BR:cex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CSE_01750 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162293..163453
Genome map
AA seq 386 aa AA seqDB search
MFEIRMPKFGLSMEEGTITKWYKKVGDFVKKGEPLVEVESEKIINTLESPFEGILKVIKV
NEGETAKVGEIIGLIGSEDETIKEITEEKRVITSEESKVRKLTESKIGEEKSEEVILASP
AAKRLAKEYGVDLSNIKGTGPSGRIVENDVIAFVEKMKQTKPVSKKIPLDPVRKRIMDNL
VKSYKESVLVTNITKIDLTNLISFKKEFPDITLTAFFVKIVSNVLKDFPKFNAHFDGNEL
EIFDAINIGVAFDTANGLIVPVIRNVQEKSLKEIAQELQTLKAKVEENSLNVDDLTGSTF
TITNLGMMRTDMFTPVLNGKEVAILGIGRTLKEPTVAEDKVVVRDFAYFSLSYDHRVIDG
ADAARFLGKLAEYFELTDNFQKINKI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaataagaatgcccaaatttgggctttcaatggaagagggcaccattacaaaa
tggtacaagaaggttggggattttgttaaaaaaggcgaacctcttgttgaagttgaatcc
gaaaagataattaacacgcttgaatcaccttttgaaggtatccttaaagtaattaaggta
aatgaaggagaaaccgcaaaagttggagaaattattggtctaattggaagtgaagatgaa
acgataaaagaaattactgaagagaaaagagtaattacttctgaggagagtaaagtaagg
aaacttaccgaatcgaaaataggagaagagaaatcggaagaggttattcttgcttcacct
gccgctaaaagacttgcaaaagagtatggtgtagatctttcgaatattaaaggcacagga
ccatcgggtcgcattgttgagaacgatgtaattgcttttgttgagaaaatgaaacaaact
aagccagtctctaaaaaaattcctcttgaccctgtaagaaaaagaatcatggataacctt
gttaagtcctacaaagagtcggttcttgtaacaaacataactaaaatagatttaacgaat
ttaatttcttttaaaaaggagtttcctgatattacacttactgcgtttttcgttaagata
gtttctaatgttttaaaggattttccaaaatttaatgcacattttgatggaaatgaactt
gaaatttttgatgcaattaacattggtgttgcatttgacacggctaacggtcttattgtc
ccagttataaggaatgttcaggaaaaatctcttaaagaaattgcgcaagaacttcaaaca
ctaaaagcaaaagtagaagaaaactctttgaacgtagatgatttaactggttcaacgttt
acaattacaaatcttggtatgatgagaacagatatgtttacaccagttttaaatggtaaa
gaagttgccattcttggcatagggaggactttaaaagagcctaccgttgccgaggataaa
gttgttgtaagagactttgcttactttagtttgtcttacgaccatcgtgtaattgacggt
gcagatgctgcaagatttttaggaaagcttgcagaatattttgagttaacagacaatttt
caaaaaataaataaaatttaa

DBGET integrated database retrieval system