KEGG   Caldisericum exile: CSE_03430Help
Entry
CSE_03430         CDS       T01804                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_03430 (gpmA)
   01230 Biosynthesis of amino acids
    CSE_03430 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_03430 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CSE_03430 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSE_03430 (gpmA)
Enzymes [BR:cex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CSE_03430 (gpmA)
Exosome [BR:cex04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CSE_03430 (gpmA)
  Exosomal proteins of melanoma cells
   CSE_03430 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(332985..333737)
Genome map
AA seq 250 aa AA seqDB search
MYKLVLLRHGESEWNKENRFTGWTDVDLSERGVEEAHFAAKLLKEQGYVFDVAFTSVLKR
AIKTLWIVLEDIDLMWIPEYKHWRLNERHYGALQGLNKAEMAKRYGEEQVLLWRRSYDVP
PPPLEKDDPRNPRFDPKYKDLKDDEIPLSESLKDTLNRVLPYYHSTIAPLVKEGKRVIIA
AHGNSLRALVKYLDNISDEEIPHLNIPTGIPLVYELDENLNAVNHYYLADEKTLQEAIER
VKNQIKEDPK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataaactcgttttattaaggcatggtgagagtgaatggaacaaagaaaatagattc
actggatggaccgatgtagatttatctgaaagaggagttgaagaggctcactttgctgct
aaattattaaaagaacagggatatgtatttgatgtagcatttacctctgttttgaaaagg
gcaattaaaaccctctggattgtgcttgaggatatagacttaatgtggataccagagtac
aaacattggagattaaatgaaaggcactatggagcactccaaggattaaacaaggcagaa
atggcaaaaagatatggagaagagcaagtgcttttgtggagaagatcgtatgatgtacca
cctccaccgcttgaaaaagatgacccaaggaatccaaggttcgatccaaaatacaaagat
ttgaaagacgatgaaattccactttctgaatctttgaaagatacactcaatagagtgctt
ccatattatcattcaactattgcaccattagtaaaagaaggaaaaagagttattattgct
gcacacggaaactctttaagagcacttgtaaaatatcttgataacatttccgacgaagaa
attccacacctcaatattccaacaggcattccgcttgtttatgaacttgatgagaactta
aatgcagttaaccactactaccttgcagatgaaaagacgcttcaggaagcaatagaaaga
gtaaaaaaccagataaaagaagacccaaaataa

DBGET integrated database retrieval system