KEGG   Caldisericum exile: CSE_03730Help
Entry
CSE_03730         CDS       T01804                                 

Gene name
pepV
Definition
putative peptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cex  Caldisericum exile
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cex01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cex00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(360674..362002)
Genome map
AA seq 442 aa AA seqDB search
MEKFIDENKQRLVEITQEIIRIPSVEDNPTEGAPFGENVKNALLLALQISKDLGFRTVNI
DNIVGYAEFGEGKDVISVLGHLDVVPEGTGWTYPPYGAEIHDGKIYGRGAIDDKGPTMAA
LFGAYTLKETGAKLSKRIRIVFGTNEETGWKCMAHFKNVVHDPLIGFTPDAEFPLINREK
GILNVTLRSDFNSKNEEVKITGGNRPNMVPDYAKAEFNDEVYLKDLEEGVEVKGTIVEAH
GKSAHGALPEQGVNAIVKLSNAIVDVVKHPEVKKVLEFIVKHVGTDVYGGLMGIANVDSL
SGKLTMNLGVIEINESSGILTFNIRYPISDNFERIIYGFNKVAEVYGLKVSEYRNQNPLY
VKEDSELVKILLNVFEKTTGRKGYTLSIGGGTYARAMDLGVAFGPTFEEMEKVEHMANEY
IAIDHLVNLAKIYGNALYELAK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattcatagacgaaaataagcaaaggcttgttgaaattacacaagaaatcatt
aggattccaagtgtagaagataatcctacggaaggagctccatttggagaaaatgtgaag
aatgcacttttgcttgcacttcaaatttcaaaagatctcggttttagaacagttaacatt
gataatattgtgggatatgcagaatttggagaagggaaagatgtaataagcgtacttgga
caccttgatgttgttcccgagggaactggttggacttatccaccgtatggagcagaaatt
cacgatggaaaaatctacggcagaggcgctatcgacgacaaaggcccaacaatggctgca
ctttttggtgcatatactcttaaagaaaccggggcaaaactttcgaaaagaataagaatc
gtttttgggacaaacgaggaaacaggctggaaatgtatggcacatttcaagaatgtagtc
catgacccacttattggctttacccctgatgcggaatttcccttgattaacagagaaaaa
ggaattttaaatgtaacactacgaagtgattttaattcaaaaaacgaagaagtaaaaatt
actggtggaaaccgtccaaatatggtgcccgactacgcaaaggcagagtttaatgatgaa
gtttatttaaaagatcttgaagaaggagttgaagtaaaaggaacgattgttgaggcgcat
ggaaaatctgcgcacggtgctctcccagagcagggggtaaatgcaattgttaaactgtca
aatgcaatcgtcgatgtagtaaaacatccggaagttaaaaaagttcttgaatttatagtt
aaacatgttggaactgatgtctacggcgggctcatgggtattgcaaatgttgattctctt
tcaggaaaattaacgatgaacttaggcgtaattgaaataaatgaatcttcgggaatatta
actttcaacataaggtatccaatctctgacaattttgagcgtattatttatggctttaat
aaggtggcagaagtttacggcttgaaggtttcagaatatagaaatcaaaatcctctttat
gtaaaggaagactcggagttagtaaaaatacttcttaacgtatttgaaaagacaacggga
agaaaaggttatacgctttcaattggtggcggtacatacgcaagagcgatggatttaggt
gttgcctttggcccaacattcgaggagatggagaaagttgaacatatggcaaatgaatat
atcgcaatagaccatcttgtgaatttagcaaaaatctatgggaatgcactctacgaactt
gcaaaatag

DBGET integrated database retrieval system