KEGG   Caldisericum exile: CSE_05360Help
Entry
CSE_05360         CDS       T01804                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cex  Caldisericum exile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CSE_05360 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSE_05360 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CSE_05360 (thrC)
Enzymes [BR:cex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CSE_05360 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508991..510253
Genome map
AA seq 420 aa AA seqDB search
MERVLKCIRCGKTYDIFSSKTRCECGGLLEVSIKDELTPSLKDEFLKRRESFKPYDQSGV
WRYREFVLDIEEDSIVTLPEGRTNLYKKVVDGMEVYFKHEGENPTGSFKDRGMTVGVTVA
KKLGFKITACASTGNTSASLSSYSAHAGLKSVVFIPKGKVAFGKLSQALSYGANVLEIAS
DFDYAMKLVEEASYEYKLYLLNSLNPLRLEGQKTIIINTLEELNFNVPDWIILPGGNLGN
TSAFGKALKELYEFHFIDKIPRLAVIQAEGASPFYNAFKNDFKTFEPMKAETIATAIRIG
NPVNYEKAVQSIKFTNGVVESVTDDEILEAKKDIDNLGIGCEPSSASTLAGLRKLRKNGI
IKKSDTVILILTGNILKDPDTSISLHTGKIKNVPIENRFFEIITLKDLENTLKKITSEVS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtacttaaatgtattaggtgtggaaaaacttatgatattttttcatccaaa
actcgctgtgagtgtggaggattgcttgaagtaagcataaaagacgaactaactccctcg
ttaaaggatgaatttcttaaaagaagggagtcgtttaagccttatgatcaaagtggtgtt
tggcgatacagggaatttgtgcttgatattgaagaagactcaattgttacactccccgag
ggtagaacaaatctctacaaaaaagtcgttgatggaatggaagtttactttaaacacgaa
ggagaaaatcccactggttcttttaaggataggggaatgactgttggtgtaactgttgct
aagaaacttggatttaaaattacagcgtgtgcctcaacgggcaatacttcagcatctctt
tcaagttattctgcacatgcaggacttaaaagtgttgtttttattcctaaaggcaaggtt
gcttttggcaagttatcgcaggctctttcgtatggtgcaaatgtactggaaatagcatcc
gattttgactatgcaatgaaacttgtagaagaggcaagttatgaatacaaactttatctt
cttaattctttaaacccgcttcgccttgaaggacaaaagacaattattataaatacgctt
gaagaactcaattttaacgtccccgattggattattttgcctggtggcaaccttggaaat
acctctgcatttggaaaggcactaaaagaactttatgaatttcattttattgacaaaatt
ccacgccttgcagttattcaggcagaaggtgcttcaccattctataatgctttcaaaaat
gattttaaaacatttgagccaatgaaagcggagaccattgcaacagcaattcgcattgga
aatcccgtaaactacgaaaaggcagtgcaatccattaaatttacgaatggtgttgttgaa
agtgtaactgatgacgaaatccttgaagcaaaaaaggacattgataaccttggcattggt
tgtgaaccatcgagtgcttcaacacttgcaggattaagaaaactccgaaagaatggcatc
attaaaaaaagcgacacagttattttaattcttacaggtaatattttgaaagaccctgac
acatcaattagtttgcatacgggaaaaattaaaaatgtcccaattgaaaatagatttttt
gaaatcattacactcaaagaccttgaaaatactttaaagaaaatcacatcggaggtatct
tag

DBGET integrated database retrieval system