KEGG   Caldisericum exile: CSE_05360Help
Entry
CSE_05360         CDS       T01804                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cex  Caldisericum exile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CSE_05360 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSE_05360 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CSE_05360 (thrC)
Enzymes [BR:cex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CSE_05360 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508991..510253
Genome map
AA seq 420 aa AA seqDB search
MERVLKCIRCGKTYDIFSSKTRCECGGLLEVSIKDELTPSLKDEFLKRRESFKPYDQSGV
WRYREFVLDIEEDSIVTLPEGRTNLYKKVVDGMEVYFKHEGENPTGSFKDRGMTVGVTVA
KKLGFKITACASTGNTSASLSSYSAHAGLKSVVFIPKGKVAFGKLSQALSYGANVLEIAS
DFDYAMKLVEEASYEYKLYLLNSLNPLRLEGQKTIIINTLEELNFNVPDWIILPGGNLGN
TSAFGKALKELYEFHFIDKIPRLAVIQAEGASPFYNAFKNDFKTFEPMKAETIATAIRIG
NPVNYEKAVQSIKFTNGVVESVTDDEILEAKKDIDNLGIGCEPSSASTLAGLRKLRKNGI
IKKSDTVILILTGNILKDPDTSISLHTGKIKNVPIENRFFEIITLKDLENTLKKITSEVS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtacttaaatgtattaggtgtggaaaaacttatgatattttttcatccaaa
actcgctgtgagtgtggaggattgcttgaagtaagcataaaagacgaactaactccctcg
ttaaaggatgaatttcttaaaagaagggagtcgtttaagccttatgatcaaagtggtgtt
tggcgatacagggaatttgtgcttgatattgaagaagactcaattgttacactccccgag
ggtagaacaaatctctacaaaaaagtcgttgatggaatggaagtttactttaaacacgaa
ggagaaaatcccactggttcttttaaggataggggaatgactgttggtgtaactgttgct
aagaaacttggatttaaaattacagcgtgtgcctcaacgggcaatacttcagcatctctt
tcaagttattctgcacatgcaggacttaaaagtgttgtttttattcctaaaggcaaggtt
gcttttggcaagttatcgcaggctctttcgtatggtgcaaatgtactggaaatagcatcc
gattttgactatgcaatgaaacttgtagaagaggcaagttatgaatacaaactttatctt
cttaattctttaaacccgcttcgccttgaaggacaaaagacaattattataaatacgctt
gaagaactcaattttaacgtccccgattggattattttgcctggtggcaaccttggaaat
acctctgcatttggaaaggcactaaaagaactttatgaatttcattttattgacaaaatt
ccacgccttgcagttattcaggcagaaggtgcttcaccattctataatgctttcaaaaat
gattttaaaacatttgagccaatgaaagcggagaccattgcaacagcaattcgcattgga
aatcccgtaaactacgaaaaggcagtgcaatccattaaatttacgaatggtgttgttgaa
agtgtaactgatgacgaaatccttgaagcaaaaaaggacattgataaccttggcattggt
tgtgaaccatcgagtgcttcaacacttgcaggattaagaaaactccgaaagaatggcatc
attaaaaaaagcgacacagttattttaattcttacaggtaatattttgaaagaccctgac
acatcaattagtttgcatacgggaaaaattaaaaatgtcccaattgaaaatagatttttt
gaaatcattacactcaaagaccttgaaaatactttaaagaaaatcacatcggaggtatct
tag

DBGET integrated database retrieval system