KEGG   Caldisericum exile: CSE_05360Help
Entry
CSE_05360         CDS       T01804                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cex  Caldisericum exile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cex01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cex00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cex00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508991..510253
Genome map
AA seq 420 aa AA seqDB search
MERVLKCIRCGKTYDIFSSKTRCECGGLLEVSIKDELTPSLKDEFLKRRESFKPYDQSGV
WRYREFVLDIEEDSIVTLPEGRTNLYKKVVDGMEVYFKHEGENPTGSFKDRGMTVGVTVA
KKLGFKITACASTGNTSASLSSYSAHAGLKSVVFIPKGKVAFGKLSQALSYGANVLEIAS
DFDYAMKLVEEASYEYKLYLLNSLNPLRLEGQKTIIINTLEELNFNVPDWIILPGGNLGN
TSAFGKALKELYEFHFIDKIPRLAVIQAEGASPFYNAFKNDFKTFEPMKAETIATAIRIG
NPVNYEKAVQSIKFTNGVVESVTDDEILEAKKDIDNLGIGCEPSSASTLAGLRKLRKNGI
IKKSDTVILILTGNILKDPDTSISLHTGKIKNVPIENRFFEIITLKDLENTLKKITSEVS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtacttaaatgtattaggtgtggaaaaacttatgatattttttcatccaaa
actcgctgtgagtgtggaggattgcttgaagtaagcataaaagacgaactaactccctcg
ttaaaggatgaatttcttaaaagaagggagtcgtttaagccttatgatcaaagtggtgtt
tggcgatacagggaatttgtgcttgatattgaagaagactcaattgttacactccccgag
ggtagaacaaatctctacaaaaaagtcgttgatggaatggaagtttactttaaacacgaa
ggagaaaatcccactggttcttttaaggataggggaatgactgttggtgtaactgttgct
aagaaacttggatttaaaattacagcgtgtgcctcaacgggcaatacttcagcatctctt
tcaagttattctgcacatgcaggacttaaaagtgttgtttttattcctaaaggcaaggtt
gcttttggcaagttatcgcaggctctttcgtatggtgcaaatgtactggaaatagcatcc
gattttgactatgcaatgaaacttgtagaagaggcaagttatgaatacaaactttatctt
cttaattctttaaacccgcttcgccttgaaggacaaaagacaattattataaatacgctt
gaagaactcaattttaacgtccccgattggattattttgcctggtggcaaccttggaaat
acctctgcatttggaaaggcactaaaagaactttatgaatttcattttattgacaaaatt
ccacgccttgcagttattcaggcagaaggtgcttcaccattctataatgctttcaaaaat
gattttaaaacatttgagccaatgaaagcggagaccattgcaacagcaattcgcattgga
aatcccgtaaactacgaaaaggcagtgcaatccattaaatttacgaatggtgttgttgaa
agtgtaactgatgacgaaatccttgaagcaaaaaaggacattgataaccttggcattggt
tgtgaaccatcgagtgcttcaacacttgcaggattaagaaaactccgaaagaatggcatc
attaaaaaaagcgacacagttattttaattcttacaggtaatattttgaaagaccctgac
acatcaattagtttgcatacgggaaaaattaaaaatgtcccaattgaaaatagatttttt
gaaatcattacactcaaagaccttgaaaatactttaaagaaaatcacatcggaggtatct
tag

DBGET integrated database retrieval system