KEGG   Caldisericum exile: CSE_05480Help
Entry
CSE_05480         CDS       T01804                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cex  Caldisericum exile
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CSE_05480 (galU)
   00052 Galactose metabolism
    CSE_05480 (galU)
   00500 Starch and sucrose metabolism
    CSE_05480 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CSE_05480 (galU)
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CSE_05480 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(522263..523135)
Genome map
AA seq 290 aa AA seqDB search
MKEIKKVVIPVGGFGTRLLPITKSQPKEMLPIVDKPAVQYVVEEAIDSGIKDILLITGRG
KRAIEDYFDYAIELEQELEQKGKHDLLKIVRETSELASIFYVRQKLARGLGDAVYHAKGF
INDEYFGVLLADDIIDADVPVLKQMIEIHKKYGGNVIAVMKVPISEVKSYGVIEAKKIGD
RIYEVKDLIEKPDPMESPSNLAIVGRYILNHTIFEALEKTEPGKNGEIQLTDAIRKLLLK
EHVYAYEFEGTRYDVGEKLGLIKANIAFSFKREDLKEELKKYLKDLCKGD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagattaagaaagtggtaattccggtaggtggatttggaacaaggcttcttcca
ataactaaatcacaaccaaaagaaatgcttcccattgttgataaaccggctgttcaatat
gtcgtagaagaggcaatagattcgggcattaaggacatcttacttataactggaagagga
aaaagagcaatcgaggattactttgattatgctattgaacttgaacaggaacttgaacaa
aagggaaagcatgaccttttaaagatagtaagagaaacaagcgagcttgcttcaattttc
tatgtaagacagaaacttgcaagaggcttaggggatgctgtataccatgcaaagggattt
ataaatgatgaatactttggagtgcttcttgcagatgacattatagatgcagatgtgcct
gttttaaaacaaatgattgaaattcacaaaaagtatggtgggaatgtcattgcggttatg
aaagtgcctataagtgaagttaaatcatatggagtgattgaagcaaaaaagattggagat
cgtatttatgaagtgaaagatcttattgagaagccagacccaatggaatcaccgtcaaac
cttgcaattgttggaagatatattttgaaccatacaatttttgaagcactggaaaaaaca
gaacctggaaaaaatggggaaatacaactaactgatgcaataagaaaacttctattaaaa
gaacatgtttatgcatatgaatttgaaggcacgcgttatgatgttggcgaaaagttaggc
ctcatcaaggcaaatattgccttctcttttaaaagggaggacctaaaagaagaattaaag
aagtatctaaaagacctatgcaaaggagactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system