KEGG   Caldisericum exile: CSE_06840Help
Entry
CSE_06840         CDS       T01804                                 

Gene name
porC
Definition
(GenBank) pyruvate synthase subunit PorC (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_06840 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_06840 (porC)
   00020 Citrate cycle (TCA cycle)
    CSE_06840 (porC)
   00620 Pyruvate metabolism
    CSE_06840 (porC)
   00640 Propanoate metabolism
    CSE_06840 (porC)
   00650 Butanoate metabolism
    CSE_06840 (porC)
  Energy metabolism
   00680 Methane metabolism
    CSE_06840 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CSE_06840 (porC)
Enzymes [BR:cex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CSE_06840 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
657805..658392
Genome map
AA seq 195 aa AA seqDB search
MAVQTKKGVYEVRFHGRAGQGAKSGSQMLALAAFKEGKSIQAFPEYGSERRGAPTVAYTR
ISDKEIRTHEPIVQPDAVLVFDFGLAKNIPVTAGLDEENGVLIVNTTKTPEEIRQITGFK
GKIYTVDATGISLDLLKMDAPNVPMLGALVRATNIVKLETLEDVIREEFLDKIGEEKVQK
NIIGLKRGFEEAKNG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcaaacaaaaaaaggtgtttatgaagtaagatttcatggaagagcaggacaa
ggtgcaaaatctggctctcagatgcttgcccttgctgcattcaaagaaggtaaatcaata
caggctttcccagaatatggttctgagcgacgtggagctccaactgttgcttatacaaga
atttccgataaagaaatccgtactcatgaaccaatagtgcaaccggacgcagtgcttgta
tttgactttggccttgcaaaaaacattccggtcacagcaggtcttgacgaggaaaacggg
gttctgattgtgaacactacaaagactccagaggaaataaggcaaataaccggatttaaa
ggaaagatttacacggtggatgcaactgggatttccttagatttgcttaagatggatgca
ccaaatgtcccaatgctcggtgcacttgtaagagcgactaacattgtcaaattagaaaca
cttgaagatgtaattagagaagaatttttagacaaaattggtgaagaaaaagtccagaaa
aacataattggtcttaaaagaggctttgaggaggcaaaaaatggctga

DBGET integrated database retrieval system