KEGG   Caldisericum exile: CSE_06850Help
Entry
CSE_06850         CDS       T01804                                 

Gene name
porD
Definition
(GenBank) pyruvate synthase subunit PorD
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cex  Caldisericum exile
Pathway
cex00010  Glycolysis / Gluconeogenesis
cex00020  Citrate cycle (TCA cycle)
cex00620  Pyruvate metabolism
cex00640  Propanoate metabolism
cex00650  Butanoate metabolism
cex00680  Methane metabolism
cex01100  Metabolic pathways
cex01120  Microbial metabolism in diverse environments
cex01130  Biosynthesis of antibiotics
cex01200  Carbon metabolism
Module
cex_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_06850 (porD)
   00020 Citrate cycle (TCA cycle)
    CSE_06850 (porD)
   00620 Pyruvate metabolism
    CSE_06850 (porD)
   00640 Propanoate metabolism
    CSE_06850 (porD)
   00650 Butanoate metabolism
    CSE_06850 (porD)
  Energy metabolism
   00680 Methane metabolism
    CSE_06850 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CSE_06850 (porD)
Enzymes [BR:cex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CSE_06850 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_21 Fer4_16 Fer4_8 Fer4_17 Fer4_4 Fer4_10 Fer4_13 Fer4_18 Fer4_15 ETF_QO
Motif
Other DBs
NCBI-ProteinID: BAL80811
UniProt: I0GJ74
Position
658385..658708
Genome map
AA seq 107 aa AA seqDB search
MAEKKGWKELMRGGDLPPATALENKTGSWRSLRPVWDPSNCIHCMICVSYCPDMAIPITK
SEEGVIGKNGRVYKGTIRLETNFDYCKGCGICAVECPTKCITMVREE
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaaaagggttggaaagaattaatgcgtggaggagacttaccacctgcaact
gcacttgaaaataaaacaggctcatggagaagtctccgacctgtctgggatccgtcaaat
tgcatacactgtatgatttgtgtatcctactgtccagatatggcgattccaataaccaaa
agtgaagaaggggtaatcggaaaaaacggaagagtgtataagggtacaataagacttgag
acaaattttgactactgcaaaggttgtggaatttgtgcggtagagtgcccaacaaaatgt
atcacgatggtaagggaagagtag

DBGET integrated database retrieval system