KEGG   Caldisericum exile: CSE_06860Help
Entry
CSE_06860         CDS       T01804                                 

Gene name
porA
Definition
(GenBank) pyruvate synthase subunit PorA (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_06860 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_06860 (porA)
   00020 Citrate cycle (TCA cycle)
    CSE_06860 (porA)
   00620 Pyruvate metabolism
    CSE_06860 (porA)
   00640 Propanoate metabolism
    CSE_06860 (porA)
   00650 Butanoate metabolism
    CSE_06860 (porA)
  Energy metabolism
   00680 Methane metabolism
    CSE_06860 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CSE_06860 (porA)
Enzymes [BR:cex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CSE_06860 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
658718..659887
Genome map
AA seq 389 aa AA seqDB search
MAKLKPLTGAQATAEAMRQINPDVVVAYPITPQTPIVEFFAQFVADGVVDTEMVPIESEH
SALSAVVGASAAGARAMCATSSQGLALMWEIVAAAPGLRLPIVMPVVNRALSAPINIHCD
HSDTMGTLTLGWVQIYSENAQEAYENMLLALRIAEHPNVLLPVMVMQDGFITSHGVEVVK
VLEDEEVKKFISERKPDRYLLNVKNPYTVGPLALPDYYFEVKRQQEVAIYNAKDVYLEVG
EELSKLTGNKYPLFEEYRTEDAEAVIVALSSTAGTAKDAVDEMREQGYKVGLIKPKLFRP
FPYKEMRETLERFKVVGVLDRSIAFGAYAPVYSEIRNALYESDKKPKLQSYIYGLGGRDI
FKTDIKKVFEELLSGNVDSQTQRYIGLRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttaaacctttaactggagcccaggcaacagccgaggcgatgcgtcagata
aacccagatgttgttgttgcgtatccaataacacctcaaacaccaattgttgaatttttt
gctcagtttgttgctgatggcgttgtagatacagaaatggttccaattgaatctgaacac
tcagccctttcagcagttgttggagcatctgctgcaggtgcaagagcaatgtgtgcaacc
tcttcgcaaggacttgctcttatgtgggaaattgtcgcagcagcaccaggcttgagactt
ccaattgttatgcctgttgtaaatagggcgttatctgcaccaattaatattcactgtgat
cactcagacacaatgggaacgttaacgcttggctgggtacaaatatattctgagaatgct
caagaggcgtatgaaaacatgctgcttgctttgagaattgcagaacatccaaatgtattg
cttcctgtgatggttatgcaggatggatttatcacaagccatggtgttgaggtcgtaaag
gtacttgaagatgaagaagtgaaaaaattcatttccgaaagaaaacctgataggtatctt
cttaatgtaaagaatccttatacagttggcccgcttgcgcttcctgattactactttgaa
gtgaagaggcagcaagaagtagcaatatataatgcaaaagatgtttatcttgaagtaggt
gaggaactttcgaaacttacaggaaataagtatccattgtttgaagaatatcggactgaa
gatgcagaagcagttattgttgcactttcatcaaccgcaggcactgcaaaggatgctgta
gatgaaatgagagagcaaggttataaagttggacttataaagccaaaactcttcagacct
ttcccatataaagaaatgagagaaacactcgagaggtttaaagttgtaggtgttcttgat
agatccattgcatttggtgcatatgcaccagtttattctgagataagaaacgcattgtat
gaatctgataagaaacctaaactccagagttatatatatggattaggtggaagagacata
tttaagactgacataaagaaggtgtttgaggaacttctaagtggaaatgttgactctcaa
acacagagatacattggtttaagggaataa

DBGET integrated database retrieval system