KEGG   Caldisericum exile: CSE_07990Help
Entry
CSE_07990         CDS       T01804                                 

Definition
putative 6-phosphofructokinase (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cex  Caldisericum exile
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSE_07990
   01230 Biosynthesis of amino acids
    CSE_07990
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_07990
   00030 Pentose phosphate pathway
    CSE_07990
   00051 Fructose and mannose metabolism
    CSE_07990
   00052 Galactose metabolism
    CSE_07990
  Energy metabolism
   00680 Methane metabolism
    CSE_07990
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CSE_07990
Protein phosphatases and associated proteins [BR:cex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CSE_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781814..782830
Genome map
AA seq 338 aa AA seqDB search
MRIGVLTGGGDCPGLNPAIRGVVYRAFDFGDEVIGFEEGWKGLIEDKKRQLSIKDVEEII
NYGGTILYTSRTNPFKEEHGPEKVIETLKKNNIDALIAIGGDDTLSVALKLHKLGVKVVG
VPKTMDNDLSQTDYTFGFFTSVEVAVDALNRLRDTAKSHKRIIVLEVMGREAGWVALFTG
IAGAADWILIPEEKPDYDKMCEHLKKKYEEKGYALVVVSEGIEIPTETTTEVDEFGHALL
QKRGVHEYVADLISKKLGISTRSAIIGHIQRGGPPTVFDRILATRVGVKAVEMVHEGDFG
KMAAISGNKVIAVPLEDAAGKQKLVDEEWIKFMKVFEK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaggattggtgttctaacgggtggtggcgattgtccagggttaaatcctgcaattaga
ggcgtggtttatagggcatttgattttggagatgaagtcattggttttgaagagggctgg
aaaggccttattgaagacaagaaaaggcaactttccataaaagatgtagaggaaattata
aattacggcggtacgattctttatacatcaagaacaaatcctttcaaggaagaacacggt
ccggaaaaggtaattgaaactctaaagaaaaacaatattgatgcattaattgcaataggt
ggagacgatactctttctgttgcactaaaacttcacaaactaggggttaaggttgtagga
gttccaaaaactatggataatgatctatcacagaccgactacacctttgggttctttact
tccgttgaagttgcggtggatgctcttaataggttaagagatacagcaaaatctcataag
agaattattgttcttgaggtaatgggaagagaagcaggttgggttgcactttttacagga
attgctggtgctgccgattggattttgattccagaagaaaagccagattacgataagatg
tgtgagcatctaaagaagaagtatgaggaaaaaggttatgctcttgttgtggtatccgag
ggtattgaaattccaaccgaaacaactaccgaagtagatgaatttggacacgcacttctc
cagaagagaggtgttcatgaatatgttgccgacttaatatctaaaaaacttggaatctct
acgcgtagcgcaatcataggacatatacaaagaggaggtcctccgacggtattcgatcgt
attcttgctacacgtgttggtgtaaaggctgtagaaatggtacatgaaggcgactttgga
aagatggctgcgatttctggaaacaaagtcattgcagttcctcttgaagatgcagcgggt
aaacaaaaactcgttgatgaggaatggattaaatttatgaaagtttttgaaaaatga

DBGET integrated database retrieval system