KEGG   Caldisericum exile: CSE_08000Help
Entry
CSE_08000         CDS       T01804                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cex  Caldisericum exile
Pathway
cex00010  Glycolysis / Gluconeogenesis
cex00030  Pentose phosphate pathway
cex00051  Fructose and mannose metabolism
cex00052  Galactose metabolism
cex00680  Methane metabolism
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01120  Microbial metabolism in diverse environments
cex01130  Biosynthesis of antibiotics
cex01200  Carbon metabolism
cex01230  Biosynthesis of amino acids
cex03018  RNA degradation
Module
cex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_08000 (pfk)
   00030 Pentose phosphate pathway
    CSE_08000 (pfk)
   00051 Fructose and mannose metabolism
    CSE_08000 (pfk)
   00052 Galactose metabolism
    CSE_08000 (pfk)
  Energy metabolism
   00680 Methane metabolism
    CSE_08000 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CSE_08000 (pfk)
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CSE_08000 (pfk)
Protein phosphatases and associated proteins [BR:cex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CSE_08000 (pfk)
Messenger RNA biogenesis [BR:cex03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CSE_08000 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAL80926
UniProt: I0GJI9
Position
782827..783789
Genome map
AA seq 320 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRSVARIGFSRGVEVIGVYEGYKGLIKKEFKKLLPRDVSGL
LEEGGTFLLSSRAEEFKDDSIQEITIKNMKEEGIEGLVVIGGNGSQSGSLSLFNKGFPVV
GVASTIDNDLWGTDYTIGFDTAVNTAIEAIDKIRDTATSHSRTFIVEVMGRNRGFIALEA
GLASGADIVLVPERRFDIEKIVENIQRGLEKKKKHHMIVTAEGAIRAQDLQTRIKEKLPE
LDVKYSVLGYIQRGGAPTRFDRIIATMFGAEAVDLLIQGNPGFVVGIKDNRIVHIPFEDA
VKKFKEINYKLYDIIEEVSV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatagcagttttaacatccgggggagatgcccccggaatgaatgctgcaata
agaagcgtagcaagaattggcttttcaaggggtgttgaggttatcggtgtttatgaagga
tacaaaggattaattaaaaaggaatttaaaaaacttcttccacgtgatgtaagcggatta
cttgaagaaggtggaacctttcttttatcctcaagagctgaggaatttaaggacgattca
atacaggaaatcacaattaagaatatgaaggaagaggggattgaaggactcgtagttatc
ggcggaaacggctcacaatctgggagtctttcacttttcaataaaggctttccggtagtt
ggagtagcatcaaccatcgacaatgacctttggggaactgactacacaattggatttgat
actgccgtgaatactgcaatagaagcgattgataaaattagagataccgcaacgtcacac
tcaagaacctttattgtcgaagtaatgggtaggaatagaggctttatagcacttgaagca
ggacttgcaagtggcgctgatatagtgcttgttcctgaaaggagatttgatattgaaaag
atagttgaaaatatacaaagaggacttgaaaagaagaaaaagcaccatatgattgtaacg
gcagaaggcgcgatacgtgctcaagaccttcagacaaggataaaagaaaaactacccgag
cttgatgtaaaatattctgtactcggttatatacaacggggtggagcacctacacgtttt
gatagaattatagcgacaatgtttggcgctgaagcagttgatttacttattcagggaaat
ccgggatttgtggttggtattaaagataaccgtattgtccatattccttttgaggacgca
gtaaagaaattcaaggagataaactataagttatacgatataatagaggaagtgtccgtg
taa

DBGET integrated database retrieval system