KEGG   Caldisericum exile: CSE_08190Help
Entry
CSE_08190         CDS       T01804                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cex  Caldisericum exile
Pathway
cex00010  Glycolysis / Gluconeogenesis
cex00051  Fructose and mannose metabolism
cex00562  Inositol phosphate metabolism
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01120  Microbial metabolism in diverse environments
cex01130  Biosynthesis of antibiotics
cex01200  Carbon metabolism
cex01230  Biosynthesis of amino acids
Module
cex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cex_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_08190 (tpiA)
   00051 Fructose and mannose metabolism
    CSE_08190 (tpiA)
   00562 Inositol phosphate metabolism
    CSE_08190 (tpiA)
Enzymes [BR:cex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CSE_08190 (tpiA)
Exosome [BR:cex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CSE_08190 (tpiA)
  Exosomal proteins of bladder cancer cells
   CSE_08190 (tpiA)
  Exosomal proteins of melanoma cells
   CSE_08190 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAL80945
UniProt: I0GJK8
Position
complement(802383..803141)
Genome map
AA seq 252 aa AA seqDB search
MKKYFLFGNWKMHKTIKETLEYADCLKGYVEYNEKFEIGVFPPFTALESFAKTVRSMPIT
VGAQNMHYEEKGAFTGEISPLMLKEIGVKYVLIGHSERRHIFKEDNGLINKKVLSAINHE
LVPVLCIGETLEERKSNKTESVIKEQIEQGLNGVNSNNFIIAYEPVWAIGTGVNATPEQA
REVHKFIRELLFHKFGESSNDISILYGGSIKVDNFGSLAEVENIDGGLVGGASLDCSTFI
ELYEILKSKKLK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttcctttttggtaattggaagatgcacaaaaccataaaagagacatta
gaatatgcagactgtctaaaaggttatgttgagtataatgaaaaatttgaaattggagta
tttcctccatttacagcgttggaaagttttgcgaaaactgtaagatctatgcccataacg
gtaggagcacagaatatgcactatgaagaaaaaggcgctttcacaggagaaatttcacca
cttatgcttaaggaaattggagtcaagtatgttcttattggacattcagaaagacggcat
atttttaaggaagataacggtcttataaacaagaaagttttatcggcgataaaccacgaa
ttagtaccagtactttgcataggtgagacattagaggaaagaaaatcaaataaaactgaa
agcgttataaaggagcagatagaacagggattaaatggagttaattcgaataattttata
attgcatacgaacctgtttgggcaattggaacaggggtgaatgcaactccggaacaggca
agggaagtacacaagtttatacgggaattgctatttcataaatttggagaaagttctaac
gatatttcaatactttatggtggaagtattaaagttgataattttggaagtctcgcagaa
gttgaaaatatagatggtggacttgttggtggtgcaagtcttgactgttcaacatttatt
gaactttacgaaatacttaaaagtaagaaattaaaataa

DBGET integrated database retrieval system