KEGG   Caldisericum exile: CSE_08410Help
Entry
CSE_08410         CDS       T01804                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cex  Caldisericum exile
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cex00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CSE_08410 (recR)
DNA repair and recombination proteins [BR:cex03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CSE_08410 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827002..827610
Genome map
AA seq 202 aa AA seqDB search
MESINSKLKSLIEEIEKLPSIGPKTAERIALYLLSLEEQEIKKFLDTLTDARANLHLCPI
CFNITDKEICEICSDESRDRSSICVVEEVNDLLAIEKTGSYKGVYHVLHGDIDPINHKGP
DQIKLKELLDRIKNSHIKEVILATNPDFSGDMTATYIAKLINSIKMDIRITRIAVGLPKE
AEIGLADTLTLSMAIKERKEYK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaattaatagtaagcttaaatctttaattgaggaaattgaaaaactaccctct
attggaccaaaaactgcggaaagaattgccctttaccttttatctttggaagagcaagaa
ataaaaaaattcttagataccttaactgatgcaagggcaaatttacatttatgccccatt
tgttttaatattactgataaagaaatttgcgagatttgcagcgatgaatcaagagatagg
tcatcaatttgcgttgtagaggaagttaacgatttacttgcaattgaaaagacgggttcc
tacaaaggagtttatcatgttcttcatggggatatcgatcctataaaccataaaggacca
gaccaaattaaattgaaagaattgcttgatagaatcaaaaattcacacataaaagaagtt
attcttgctacaaatcctgattttagtggtgatatgactgcaacttacattgcaaaactt
attaattcgattaaaatggatattaggattacaagaattgctgtcggtttaccaaaggaa
gcagaaattggacttgcagatactttaactttgtctatggcaattaaagaaagaaaggaa
tacaaataa

DBGET integrated database retrieval system