KEGG   Caldisericum exile: CSE_08970Help
Entry
CSE_08970         CDS       T01804                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cex  Caldisericum exile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CSE_08970 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSE_08970 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CSE_08970 (thrC)
Enzymes [BR:cex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CSE_08970 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(878275..879531)
Genome map
AA seq 418 aa AA seqDB search
MGHVKRLKCLVCGTEYDENEVMYTCPKCGDNGLLEVEYDYESIKREFTKEYLSNNKSYSL
WRYLPLLPINDPSKIAPLQVGFTPLYQVPRIREDLGVSNLFVKDDGRNPTASLKDRASAI
VVSKAQELGKTEITCASTGNAASSLAGATASLGLKSYIFVPKNAPKAKLTQLLVFGATVF
AVNGTYDEAFDLSIKATREFGWYNRNTGFNPYTVEGKKTVALEIAEQLSFDVPNYVFVSV
GDGNIISGVYKGFFDLLNLGFIDRMPKIVAVQAEGCSPVVDAVNGDGIIKPVVPNTIADS
ISVGIPRSGIMAVKYIKNSNGFGIKVSDEEILKAIKYLGTMSGIFAEPAASTSFAGYLKA
LKEGLIKGSDKVVVIITGNGLKDIDSAMKSVKEPIYIDPTIEDVKRKVMEINELFRRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatgttaaaagacttaagtgtttagtttgcgggacagaatacgatgaaaacgag
gtaatgtacacttgtcccaagtgtggagataatggattgcttgaagttgaatatgactac
gaatctataaaaagagaatttactaaagagtatctttcaaataataaaagttactcatta
tggcgatatttgcctctacttccaattaatgatccttcaaaaattgcgcctctccaagtt
ggatttacccctctttatcaggttcccagaattcgggaggatttaggagtttcaaacctt
ttcgttaaagatgatggcagaaaccctaccgcctctttgaaggatagagcttctgcaata
gtagttagcaaggctcaagaattaggcaaaactgaaattacttgtgcatctaccggaaat
gctgcttcttctcttgcaggagcaactgcgtcgcttggattgaagtcttatatttttgtt
cctaaaaatgctccaaaagccaaattaactcaacttttagtgttcggagcaactgtcttt
gcagttaatggcacttatgatgaagcatttgatctttcaataaaagcaacgagagaattt
ggatggtacaatagaaacacaggttttaatccatatactgttgaaggtaagaaaaccgtt
gcacttgaaattgcagagcagttaagtttcgatgttccaaattatgtttttgtatccgtt
ggggatgggaatattatttcaggagtttataaaggattttttgatttgttgaaccttggc
tttatagataggatgcctaagatagttgcagtccaggcggaaggttgttctccagttgta
gatgctgtaaatggggatggtataataaaacctgttgtgccaaacacgattgcagatagt
atatcagttggtattcctcgatctggaatcatggctgttaaatacattaaaaactcgaat
ggatttggaataaaagttagtgacgaagaaattctaaaagcaataaaatatcttggaact
atgagtggtatttttgctgaacctgccgcttctacttcatttgcagggtatttaaaagct
cttaaggaaggtcttatcaaaggaagtgataaagtagttgttattatcaccggcaacggc
ttaaaggatattgatagtgccatgaaatctgtcaaagaaccgatttatatcgatccaact
attgaagatgtaaagagaaaagtaatggaaataaacgaattattccgaagaaggtga

DBGET integrated database retrieval system