KEGG   Caldisericum exile: CSE_09130Help
Entry
CSE_09130         CDS       T01804                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cex  Caldisericum exile
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CSE_09130 (gmk)
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CSE_09130 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898228..898791
Genome map
AA seq 187 aa AA seqDB search
MIIVISGPSGVGKGAVSKELVKLDPRFEIAITCTTRHPRENEIDGIDYFFVSEESFRKMI
EEGELAEYSIVHGNLYGIPQRFVDLGLNNEKDVIFQIDVQGAKKIKNKYDEALLIFLMPP
SIEALIERLNKRGTENLSEIEKRTKRAKEEIEERYLYDYVVVNDILENTVKEIYEIILKE
RKLRIGL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattatagttatatcaggtccatcaggtgttggaaaaggtgcggttagtaaagaactt
gttaaacttgatccacgttttgaaattgcaataacttgcacaacaaggcatccaagagaa
aacgaaattgatggtatagattatttttttgtaagcgaagaatccttcagaaaaatgata
gaagaaggggaattagcagagtattctattgtccatgggaatctttatggtataccacaa
agattcgtcgacttaggtttaaataacgaaaaggatgttatctttcaaattgatgtacaa
ggagcaaaaaaaattaaaaataaatatgatgaagcacttttaatatttttaatgccacca
agcatagaagcgctcatcgaaagacttaacaaaagaggaaccgaaaatttatctgagata
gaaaaaagaacaaaaagagccaaagaagagattgaagaaagatacctgtatgactatgtc
gttgtaaacgatatcttggagaatacagttaaagagatttacgagataattttaaaagag
cgtaagcttcgcatcggtctttaa

DBGET integrated database retrieval system